BLASTX nr result
ID: Gardenia21_contig00036837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00036837 (286 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03011.1| unnamed protein product [Coffea canephora] 61 3e-07 >emb|CDP03011.1| unnamed protein product [Coffea canephora] Length = 425 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -2 Query: 126 YYDDGESNGDXXXXXXXXPQLSFRAKGSPFRPSIAVIVGVLT 1 YYDDGES+G+ PQLSFR KGSPFRPSIAVIVGVLT Sbjct: 6 YYDDGESSGNSPTPLAPPPQLSFRTKGSPFRPSIAVIVGVLT 47