BLASTX nr result
ID: Gardenia21_contig00036726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00036726 (232 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02363.1| unnamed protein product [Coffea canephora] 127 3e-27 >emb|CDP02363.1| unnamed protein product [Coffea canephora] Length = 881 Score = 127 bits (319), Expect = 3e-27 Identities = 60/65 (92%), Positives = 63/65 (96%) Frame = -3 Query: 197 MASLICRTRRFLVPTKPSFSSFLALYTSPISTASAVAPANYWKTFSHIFQECSKERALNP 18 MASLICRTRRFLVPTKPSFSS+LALYT PIST SAVAPANYWKTFSHIFQECSKERAL+P Sbjct: 1 MASLICRTRRFLVPTKPSFSSYLALYTFPISTVSAVAPANYWKTFSHIFQECSKERALDP 60 Query: 17 GMQAH 3 GMQ+H Sbjct: 61 GMQSH 65