BLASTX nr result
ID: Gardenia21_contig00036487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00036487 (334 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00724.1| unnamed protein product [Coffea canephora] 81 3e-13 ref|XP_002311488.1| hypothetical protein POPTR_0008s12610g [Popu... 58 3e-06 >emb|CDP00724.1| unnamed protein product [Coffea canephora] Length = 174 Score = 81.3 bits (199), Expect = 3e-13 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -3 Query: 329 RLNSEEIEGFKDMEYRFRLASCKSRKPLLDTITEEPVFSR 210 RLN EEIEGFKDMEYRFRLASCKSRKPLLDTITEEPVFSR Sbjct: 135 RLNLEEIEGFKDMEYRFRLASCKSRKPLLDTITEEPVFSR 174 >ref|XP_002311488.1| hypothetical protein POPTR_0008s12610g [Populus trichocarpa] gi|222851308|gb|EEE88855.1| hypothetical protein POPTR_0008s12610g [Populus trichocarpa] Length = 179 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 329 RLNSEEIEGFKDMEYRFRLASCKSRKPLLDTITEEPVFSR 210 RL+ EE+EGF EY++RL+SC+SRKP+L+TI EEPV SR Sbjct: 140 RLSLEEVEGFPLPEYKYRLSSCRSRKPMLETINEEPVRSR 179