BLASTX nr result
ID: Gardenia21_contig00036444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00036444 (247 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98882.1| unnamed protein product [Coffea canephora] 81 3e-13 >emb|CDO98882.1| unnamed protein product [Coffea canephora] Length = 314 Score = 80.9 bits (198), Expect = 3e-13 Identities = 42/57 (73%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = -1 Query: 247 ESKPDPPKNSENGRRV-GFVGVDGTARDPREIKIDGKLPGSIPATAEKSPASDQKSN 80 E+ +P KNSE G +V F GVDG A D REIKIDGKLPGSIPATAEKSPAS+QKSN Sbjct: 113 EANVNPAKNSEKGTKVVRFAGVDGIAGDQREIKIDGKLPGSIPATAEKSPASEQKSN 169