BLASTX nr result
ID: Gardenia21_contig00036407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00036407 (297 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98687.1| unnamed protein product [Coffea canephora] 129 7e-28 gb|KDO57424.1| hypothetical protein CISIN_1g047944mg [Citrus sin... 75 1e-11 ref|XP_006430485.1| hypothetical protein CICLE_v10013373mg [Citr... 75 1e-11 ref|XP_010649700.1| PREDICTED: F-box protein At5g03100-like [Vit... 68 3e-09 emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] 67 4e-09 >emb|CDO98687.1| unnamed protein product [Coffea canephora] Length = 483 Score = 129 bits (325), Expect = 7e-28 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -3 Query: 196 QTPELPDRVLNFTNVQELILTVFPFHDEDKFDWIIYVLKTFTLLRSLQLNLFSPSYIRKS 17 +TPELPD+VLNFTNVQELILTVFPFHDEDKFDWIIYVLKTFT LRSLQLNLFSPSYIRKS Sbjct: 331 KTPELPDKVLNFTNVQELILTVFPFHDEDKFDWIIYVLKTFTSLRSLQLNLFSPSYIRKS 390 Query: 16 NISPR 2 NISPR Sbjct: 391 NISPR 395 >gb|KDO57424.1| hypothetical protein CISIN_1g047944mg [Citrus sinensis] Length = 452 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/56 (60%), Positives = 43/56 (76%) Frame = -3 Query: 187 ELPDRVLNFTNVQELILTVFPFHDEDKFDWIIYVLKTFTLLRSLQLNLFSPSYIRK 20 ELPD FTNV+ELIL ++PF DED WI Y+L+ F LL+ LQLNLFSPS+I++ Sbjct: 301 ELPDNGPVFTNVKELILAIYPFDDEDNLSWIAYILRAFPLLQRLQLNLFSPSFIKQ 356 >ref|XP_006430485.1| hypothetical protein CICLE_v10013373mg [Citrus clementina] gi|557532542|gb|ESR43725.1| hypothetical protein CICLE_v10013373mg [Citrus clementina] Length = 483 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/56 (60%), Positives = 43/56 (76%) Frame = -3 Query: 187 ELPDRVLNFTNVQELILTVFPFHDEDKFDWIIYVLKTFTLLRSLQLNLFSPSYIRK 20 ELPD FTNV+ELIL ++PF DED WI Y+L+ F LL+ LQLNLFSPS+I++ Sbjct: 332 ELPDNGPVFTNVKELILAIYPFDDEDNLSWIAYILRAFPLLQRLQLNLFSPSFIKQ 387 >ref|XP_010649700.1| PREDICTED: F-box protein At5g03100-like [Vitis vinifera] gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] Length = 487 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -3 Query: 187 ELPDRVLNFTNVQELILTVFPFHDEDKFDWIIYVLKTFTLLRSLQLNLFSPSYIRK 20 +LP+ FTNV++ LTVFPF D+D WI Y+LK F LL+ L+LNLFSPS+ ++ Sbjct: 338 QLPENGPTFTNVKQFELTVFPFDDDDDLSWIGYILKAFPLLQKLELNLFSPSFTKQ 393 >emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] Length = 1789 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 187 ELPDRVLNFTNVQELILTVFPFHDEDKFDWIIYVLKTFTLLRSLQLNLFSPSYIRK 20 +LP+ FTN+++ LTVFPF D+D WI Y+LK F LL+ L+LNLFSPS+ ++ Sbjct: 1640 QLPENGPTFTNIKQFELTVFPFDDDDDLSWIGYILKAFPLLQKLELNLFSPSFTKQ 1695