BLASTX nr result
ID: Gardenia21_contig00036361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00036361 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00440.1| unnamed protein product [Coffea canephora] 50 2e-06 >emb|CDP00440.1| unnamed protein product [Coffea canephora] Length = 422 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -1 Query: 120 DSSFSSNGHLGGYFCDGGIPGFRKRGNRLGSWSWVKTDLN 1 DS F SNG L YF G PGF+KRG+ LGS SWVK D N Sbjct: 22 DSRFPSNGRLEDYFRGLGNPGFKKRGHGLGSRSWVKIDQN 61 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 172 QTQYIPSNVPERVPSNT*LKF 110 QTQ IPS PE VPSN+ +F Sbjct: 5 QTQEIPSKFPEFVPSNSDSRF 25