BLASTX nr result
ID: Gardenia21_contig00036040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00036040 (294 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17858.1| unnamed protein product [Coffea canephora] 57 5e-06 >emb|CDP17858.1| unnamed protein product [Coffea canephora] Length = 476 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = -3 Query: 100 MVPQKQAEKAT--GDINVNDGTEGGEEEKVDHEP 5 MVPQKQAE+A GDI+VNDGT+GGEEE+VDHEP Sbjct: 1 MVPQKQAEEAIVPGDISVNDGTQGGEEERVDHEP 34