BLASTX nr result
ID: Gardenia21_contig00035955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00035955 (711 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04046.1| unnamed protein product [Coffea canephora] 102 2e-19 >emb|CDP04046.1| unnamed protein product [Coffea canephora] Length = 299 Score = 102 bits (255), Expect = 2e-19 Identities = 52/67 (77%), Positives = 54/67 (80%), Gaps = 2/67 (2%) Frame = +1 Query: 64 AQIAALKLEIQWLKSAAGESDSSSHVYQS--LHFPTSMSTHQKPLLHNCQPSTLPSHLHV 237 AQ AALKLEIQWLK+ GE D HV QS L FPTSMSTHQKPLLHNCQPSTL +LHV Sbjct: 233 AQNAALKLEIQWLKAVTGELDDPCHVCQSESLQFPTSMSTHQKPLLHNCQPSTLSPYLHV 292 Query: 238 ASPQPLF 258 ASPQPLF Sbjct: 293 ASPQPLF 299