BLASTX nr result
ID: Gardenia21_contig00035560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00035560 (426 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28277.1| hypothetical protein MIMGU_mgv1a017405mg [Erythra... 63 8e-08 >gb|EYU28277.1| hypothetical protein MIMGU_mgv1a017405mg [Erythranthe guttata] Length = 77 Score = 63.2 bits (152), Expect = 8e-08 Identities = 38/88 (43%), Positives = 47/88 (53%), Gaps = 4/88 (4%) Frame = -3 Query: 316 MSQKTNRHHRKPSQGAFVLPDNLSDPLPKNDAGESKAAPAPPGSTAGEAHPPLMADKSG- 140 MS++ NRH R+PSQG FVLPDNLSDPL + A AA AP HPP G Sbjct: 1 MSERANRHRRRPSQGVFVLPDNLSDPLTDDIAHAPPAAQAP--------HPPQERSAGGA 52 Query: 139 ---VPGLPPSPAKALDEMSTHNPPRESE 65 +P PP P +A ++ NP R + Sbjct: 53 GVQLPPQPPQPKRAEEK---PNPDRSGK 77