BLASTX nr result
ID: Gardenia21_contig00033729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00033729 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02626.1| unnamed protein product [Coffea canephora] 80 8e-13 >emb|CDP02626.1| unnamed protein product [Coffea canephora] Length = 418 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 114 MDLDFLKCAFDYTKRKKRWVLAFGAFYGAYKFYHLPSV 1 MDLDFLK AFDYTK+KK+WVLAFGAFYGAYKFYHLPSV Sbjct: 1 MDLDFLKWAFDYTKKKKKWVLAFGAFYGAYKFYHLPSV 38