BLASTX nr result
ID: Gardenia21_contig00033578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00033578 (224 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15764.1| unnamed protein product [Coffea canephora] 72 1e-10 emb|CDP16643.1| unnamed protein product [Coffea canephora] 61 4e-07 >emb|CDP15764.1| unnamed protein product [Coffea canephora] Length = 336 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 103 VEEEGKESEMAGQGSSWNSTSLQVLDAVLGWIAFASWSIS 222 VEEE +ESEMAGQGSSWNST LQVL VLGWIAFASWSIS Sbjct: 26 VEEEERESEMAGQGSSWNSTPLQVLHDVLGWIAFASWSIS 65 >emb|CDP16643.1| unnamed protein product [Coffea canephora] Length = 278 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 130 MAGQGSSWNSTSLQVLDAVLGWIAFASWSIS 222 MAGQGSSWNST LQVL A+LGWIAFASWSIS Sbjct: 1 MAGQGSSWNSTPLQVLHALLGWIAFASWSIS 31