BLASTX nr result
ID: Gardenia21_contig00033502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00033502 (678 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17102.1| unnamed protein product [Coffea canephora] 46 6e-10 >emb|CDP17102.1| unnamed protein product [Coffea canephora] Length = 612 Score = 46.2 bits (108), Expect(2) = 6e-10 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -2 Query: 587 LVEVVYSRNSFKIFALQFVDTGQGIIRQEIPLIFTKYVKPHSS 459 L E + F +Q +DTGQGI QEIPL+FTK+VK +SS Sbjct: 519 LSEAAFCNGQFYYLQVQVMDTGQGIDPQEIPLVFTKFVKRYSS 561 Score = 45.1 bits (105), Expect(2) = 6e-10 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = -1 Query: 342 RFTSLMGGHVRIESEGLGKGTAVPYHRQAWDLQPK 238 R T+LMGGH+RIESEGLGKGT V + + +PK Sbjct: 578 RLTNLMGGHIRIESEGLGKGTTVTFIVKLGICKPK 612