BLASTX nr result
ID: Gardenia21_contig00033496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00033496 (398 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02737.1| unnamed protein product [Coffea canephora] 67 5e-09 ref|XP_010687875.1| PREDICTED: probable histone chaperone ASF1A ... 66 1e-08 ref|XP_010552129.1| PREDICTED: histone chaperone ASF1B [Tarenaya... 66 1e-08 ref|XP_010553901.1| PREDICTED: histone chaperone ASF1B-like [Tar... 65 2e-08 ref|XP_012078039.1| PREDICTED: histone chaperone ASF1B [Jatropha... 64 3e-08 ref|XP_002528058.1| anti-silencing protein, putative [Ricinus co... 64 3e-08 ref|XP_010687876.1| PREDICTED: probable histone chaperone ASF1A ... 64 4e-08 ref|XP_009601560.1| PREDICTED: probable histone chaperone ASF1A ... 64 4e-08 ref|XP_008800925.1| PREDICTED: histone chaperone ASF1B-like [Pho... 64 4e-08 ref|XP_010062218.1| PREDICTED: histone chaperone ASF1B [Eucalypt... 64 4e-08 gb|KOM42376.1| hypothetical protein LR48_Vigan04g257400 [Vigna a... 64 6e-08 ref|XP_011035137.1| PREDICTED: histone chaperone ASF1B-like [Pop... 64 6e-08 ref|XP_002305844.2| hypothetical protein POPTR_0004s09330g [Popu... 64 6e-08 ref|XP_014499992.1| PREDICTED: histone chaperone ASF1B-like [Vig... 63 1e-07 ref|XP_006580923.1| PREDICTED: uncharacterized protein LOC100305... 63 1e-07 ref|XP_007137330.1| hypothetical protein PHAVU_009G1181000g, par... 63 1e-07 ref|XP_006391425.1| hypothetical protein EUTSA_v10019161mg [Eutr... 63 1e-07 gb|AFK45392.1| unknown [Lotus japonicus] 63 1e-07 ref|XP_003522389.1| PREDICTED: histone chaperone ASF1B-like [Gly... 63 1e-07 ref|NP_001235672.1| uncharacterized protein LOC100305970 [Glycin... 63 1e-07 >emb|CDP02737.1| unnamed protein product [Coffea canephora] Length = 217 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPAPFLTPFQFEISYECV Sbjct: 1 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 31 >ref|XP_010687875.1| PREDICTED: probable histone chaperone ASF1A isoform X1 [Beta vulgaris subsp. vulgaris] Length = 200 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 101 DKMSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 D MSAVNITNVT+LDNPAPFL+PFQFEISYEC+ Sbjct: 8 DAMSAVNITNVTILDNPAPFLSPFQFEISYECL 40 >ref|XP_010552129.1| PREDICTED: histone chaperone ASF1B [Tarenaya hassleriana] Length = 193 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPAPFLTPFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPAPFLTPFQFEISYECL 31 >ref|XP_010553901.1| PREDICTED: histone chaperone ASF1B-like [Tarenaya hassleriana] gi|729399895|ref|XP_010553902.1| PREDICTED: histone chaperone ASF1B-like [Tarenaya hassleriana] Length = 191 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSA+NITNVTVLDNPAPFLTPFQFEISYEC+ Sbjct: 1 MSAINITNVTVLDNPAPFLTPFQFEISYECL 31 >ref|XP_012078039.1| PREDICTED: histone chaperone ASF1B [Jatropha curcas] gi|802634523|ref|XP_012078041.1| PREDICTED: histone chaperone ASF1B [Jatropha curcas] gi|802634525|ref|XP_012078042.1| PREDICTED: histone chaperone ASF1B [Jatropha curcas] gi|643723450|gb|KDP33029.1| hypothetical protein JCGZ_13060 [Jatropha curcas] Length = 192 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPAPFL+PFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPAPFLSPFQFEISYECL 31 >ref|XP_002528058.1| anti-silencing protein, putative [Ricinus communis] gi|223532519|gb|EEF34308.1| anti-silencing protein, putative [Ricinus communis] Length = 193 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPAPFL+PFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPAPFLSPFQFEISYECL 31 >ref|XP_010687876.1| PREDICTED: probable histone chaperone ASF1A isoform X2 [Beta vulgaris subsp. vulgaris] gi|731353087|ref|XP_010687877.1| PREDICTED: probable histone chaperone ASF1A isoform X2 [Beta vulgaris subsp. vulgaris] gi|870850688|gb|KMT02754.1| hypothetical protein BVRB_8g193410 [Beta vulgaris subsp. vulgaris] Length = 191 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVT+LDNPAPFL+PFQFEISYEC+ Sbjct: 1 MSAVNITNVTILDNPAPFLSPFQFEISYECL 31 >ref|XP_009601560.1| PREDICTED: probable histone chaperone ASF1A [Nicotiana tomentosiformis] Length = 192 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPA FLTPFQFEISYECV Sbjct: 1 MSAVNITNVTVLDNPASFLTPFQFEISYECV 31 >ref|XP_008800925.1| PREDICTED: histone chaperone ASF1B-like [Phoenix dactylifera] Length = 187 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPAPFL PFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPAPFLNPFQFEISYECL 31 >ref|XP_010062218.1| PREDICTED: histone chaperone ASF1B [Eucalyptus grandis] gi|629103840|gb|KCW69309.1| hypothetical protein EUGRSUZ_F02799 [Eucalyptus grandis] Length = 194 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPA FLTPFQFEISYECV Sbjct: 1 MSAVNITNVTVLDNPASFLTPFQFEISYECV 31 >gb|KOM42376.1| hypothetical protein LR48_Vigan04g257400 [Vigna angularis] Length = 241 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 110 SSRDKMSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 +S MSAVNITNVTVLDNPA FLTPFQFEISYEC+ Sbjct: 46 NSNISMSAVNITNVTVLDNPASFLTPFQFEISYECL 81 >ref|XP_011035137.1| PREDICTED: histone chaperone ASF1B-like [Populus euphratica] Length = 193 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVN+TNVTVLDNPAPFL+PFQFEISYEC+ Sbjct: 1 MSAVNLTNVTVLDNPAPFLSPFQFEISYECL 31 >ref|XP_002305844.2| hypothetical protein POPTR_0004s09330g [Populus trichocarpa] gi|550340658|gb|EEE86355.2| hypothetical protein POPTR_0004s09330g [Populus trichocarpa] Length = 190 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVN+TNVTVLDNPAPFL+PFQFEISYEC+ Sbjct: 1 MSAVNLTNVTVLDNPAPFLSPFQFEISYECL 31 >ref|XP_014499992.1| PREDICTED: histone chaperone ASF1B-like [Vigna radiata var. radiata] Length = 191 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPA FLTPFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPASFLTPFQFEISYECL 31 >ref|XP_006580923.1| PREDICTED: uncharacterized protein LOC100305970 isoform X1 [Glycine max] gi|734372957|gb|KHN19982.1| Histone chaperone ASF1B [Glycine soja] gi|947102980|gb|KRH51363.1| hypothetical protein GLYMA_06G002300 [Glycine max] Length = 192 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPA FLTPFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPASFLTPFQFEISYECL 31 >ref|XP_007137330.1| hypothetical protein PHAVU_009G1181000g, partial [Phaseolus vulgaris] gi|561010417|gb|ESW09324.1| hypothetical protein PHAVU_009G1181000g, partial [Phaseolus vulgaris] Length = 36 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPA FLTPFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPASFLTPFQFEISYECL 31 >ref|XP_006391425.1| hypothetical protein EUTSA_v10019161mg [Eutrema salsugineum] gi|557087859|gb|ESQ28711.1| hypothetical protein EUTSA_v10019161mg [Eutrema salsugineum] Length = 199 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSA+NITNVTVLDNPAPF++PFQFEISYEC+ Sbjct: 1 MSAINITNVTVLDNPAPFVSPFQFEISYECL 31 >gb|AFK45392.1| unknown [Lotus japonicus] Length = 205 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPA FLTPFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPASFLTPFQFEISYECL 31 >ref|XP_003522389.1| PREDICTED: histone chaperone ASF1B-like [Glycine max] gi|734405891|gb|KHN33660.1| Histone chaperone ASF1B [Glycine soja] gi|947112370|gb|KRH60672.1| hypothetical protein GLYMA_04G002500 [Glycine max] Length = 191 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPA FLTPFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPASFLTPFQFEISYECL 31 >ref|NP_001235672.1| uncharacterized protein LOC100305970 [Glycine max] gi|255627147|gb|ACU13918.1| unknown [Glycine max] Length = 192 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 95 MSAVNITNVTVLDNPAPFLTPFQFEISYECV 3 MSAVNITNVTVLDNPA FLTPFQFEISYEC+ Sbjct: 1 MSAVNITNVTVLDNPASFLTPFQFEISYECL 31