BLASTX nr result
ID: Gardenia21_contig00033332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00033332 (214 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04952.1| unnamed protein product [Coffea canephora] 77 9e-18 >emb|CDP04952.1| unnamed protein product [Coffea canephora] Length = 95 Score = 77.0 bits (188), Expect(2) = 9e-18 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -2 Query: 171 WLGFLLFHPYLFFLKFVCLVIANLYI-QWIFGLYVPFLIYLDLQLMNLLHSICCMPFC 1 +L FL + +L FLKFVCLV+ WIFG PFL+YL+LQLMNLLH++CCMPFC Sbjct: 32 FLEFLFSNHHLLFLKFVCLVMVTACTYNWIFGSCAPFLVYLELQLMNLLHNVCCMPFC 89 Score = 39.7 bits (91), Expect(2) = 9e-18 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 212 ICQGVFVTVCCIILGWG 162 ICQGVFV VCC+ILGWG Sbjct: 7 ICQGVFVIVCCMILGWG 23