BLASTX nr result
ID: Gardenia21_contig00033096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00033096 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14664.1| unnamed protein product [Coffea canephora] 93 9e-17 >emb|CDP14664.1| unnamed protein product [Coffea canephora] Length = 355 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/54 (83%), Positives = 47/54 (87%), Gaps = 1/54 (1%) Frame = +1 Query: 97 QSTFMLLHHPQFTTKLQQFRHFPPSTKFPFQPRNKGRLLEKKIQTS-IFEGHYI 255 QST MLL HPQ TT+LQQ RHFPPS KFPFQP+NKGRLLEKKIQTS I EGHYI Sbjct: 300 QSTLMLLPHPQLTTELQQLRHFPPSRKFPFQPKNKGRLLEKKIQTSNILEGHYI 353