BLASTX nr result
ID: Gardenia21_contig00033090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00033090 (189 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17228.1| unnamed protein product [Coffea canephora] 107 3e-21 >emb|CDP17228.1| unnamed protein product [Coffea canephora] Length = 715 Score = 107 bits (268), Expect = 3e-21 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = -2 Query: 188 RMPEKRIAKGQKRKRNTKVSKKMARKKQRRNHGLPRKSRHNNDGEFRKSKMGLVERNKK 12 RMPEKRI+KGQKRKRNTKVSKKM RKKQR NHGLPRKSRHN DG+FRKSK LVE+NKK Sbjct: 77 RMPEKRISKGQKRKRNTKVSKKMVRKKQRENHGLPRKSRHNTDGDFRKSKTRLVEKNKK 135