BLASTX nr result
ID: Gardenia21_contig00032967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032967 (430 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98890.1| unnamed protein product [Coffea canephora] 104 2e-20 emb|CDO98889.1| unnamed protein product [Coffea canephora] 69 1e-09 ref|XP_006451489.1| hypothetical protein CICLE_v10010692mg [Citr... 67 7e-09 ref|XP_013463276.1| mTERF protein [Medicago truncatula] gi|65739... 66 1e-08 ref|XP_012474947.1| PREDICTED: uncharacterized protein LOC105791... 64 6e-08 ref|XP_010270366.1| PREDICTED: uncharacterized protein LOC104606... 64 6e-08 ref|XP_010649758.1| PREDICTED: uncharacterized protein LOC100257... 63 1e-07 ref|XP_013463290.1| mTERF protein [Medicago truncatula] gi|65739... 62 1e-07 ref|XP_002274845.1| PREDICTED: uncharacterized protein LOC100252... 62 1e-07 emb|CAN77550.1| hypothetical protein VITISV_017394 [Vitis vinifera] 62 1e-07 gb|KHN02984.1| hypothetical protein glysoja_009850 [Glycine soja] 61 3e-07 ref|XP_002321027.2| hypothetical protein POPTR_0014s12770g [Popu... 61 3e-07 ref|XP_011033588.1| PREDICTED: uncharacterized protein LOC105132... 61 4e-07 ref|XP_007138895.1| hypothetical protein PHAVU_009G246600g [Phas... 61 4e-07 ref|XP_013463278.1| mTERF protein [Medicago truncatula] gi|65739... 60 5e-07 ref|XP_013463275.1| transcription termination factor family prot... 60 5e-07 ref|XP_002276393.1| PREDICTED: uncharacterized protein LOC100240... 60 5e-07 emb|CAN78550.1| hypothetical protein VITISV_003242 [Vitis vinifera] 60 5e-07 ref|XP_009361990.1| PREDICTED: uncharacterized protein LOC103952... 60 6e-07 ref|XP_013463282.1| mTERF protein [Medicago truncatula] gi|65739... 60 6e-07 >emb|CDO98890.1| unnamed protein product [Coffea canephora] Length = 396 Score = 104 bits (260), Expect = 2e-20 Identities = 53/64 (82%), Positives = 56/64 (87%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQENR 251 KK I+PRC VHQALL KGLLKKNVRL+TL YPEKIFLKRFV+ FEKEAAELLKVYQE R Sbjct: 333 KKTIIPRCLVHQALLSKGLLKKNVRLATLLVYPEKIFLKRFVECFEKEAAELLKVYQEKR 392 Query: 250 *GTK 239 GTK Sbjct: 393 KGTK 396 >emb|CDO98889.1| unnamed protein product [Coffea canephora] Length = 388 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/57 (54%), Positives = 45/57 (78%) Frame = -1 Query: 427 KNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 K I PRCSV+ L +KGL++KN+ L+ + PEK FL+RFV+R+++EA ELL++YQE Sbjct: 326 KTIAPRCSVYNVLRMKGLVRKNLSLARCLTCPEKFFLERFVQRYKEEAPELLELYQE 382 >ref|XP_006451489.1| hypothetical protein CICLE_v10010692mg [Citrus clementina] gi|557554715|gb|ESR64729.1| hypothetical protein CICLE_v10010692mg [Citrus clementina] Length = 191 Score = 66.6 bits (161), Expect = 7e-09 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 KK IVPR SV Q LL K L+K ++ LSTLF EK+FLKRFV +++EA++LLK+Y E Sbjct: 125 KKRIVPRGSVAQGLLSKVLIKNDLGLSTLFHTSEKLFLKRFVNHYKEEASQLLKLYDE 182 >ref|XP_013463276.1| mTERF protein [Medicago truncatula] gi|657397572|gb|KEH37288.1| mTERF protein [Medicago truncatula] Length = 410 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQ 260 +K I+PR SV Q LL+KGL KKN L+T F+Y EK+FL +FV RF++E+ LLK+Y+ Sbjct: 337 EKRIIPRASVLQFLLMKGLRKKNASLTTPFTYSEKLFLSKFVFRFKEESDYLLKLYE 393 >ref|XP_012474947.1| PREDICTED: uncharacterized protein LOC105791428 [Gossypium raimondii] gi|763757021|gb|KJB24352.1| hypothetical protein B456_004G141300 [Gossypium raimondii] Length = 402 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQ 260 +K I+PRCSV Q LL KGL+K+ L+T+ EK FL+RFV R+++E ELL VYQ Sbjct: 338 EKRIIPRCSVFQVLLSKGLIKEGFSLTTVLLPVEKRFLERFVMRYQEEVPELLSVYQ 394 >ref|XP_010270366.1| PREDICTED: uncharacterized protein LOC104606719 [Nelumbo nucifera] gi|720045974|ref|XP_010270367.1| PREDICTED: uncharacterized protein LOC104606719 [Nelumbo nucifera] Length = 388 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/57 (52%), Positives = 44/57 (77%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQ 260 +K I+PR V Q LL KGL+KK++ L+T+FS + +FL++FV +++ E AELLKVYQ Sbjct: 326 EKRIIPRWFVTQVLLSKGLIKKDLALNTVFSISDSLFLEKFVIKYKDETAELLKVYQ 382 >ref|XP_010649758.1| PREDICTED: uncharacterized protein LOC100257952 [Vitis vinifera] gi|731388829|ref|XP_010649759.1| PREDICTED: uncharacterized protein LOC100257952 [Vitis vinifera] Length = 389 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K I+PR SV Q LL KGL+ K++ L LF EK FL+RFV +++EA +L+K+YQE Sbjct: 328 EKRIIPRYSVVQVLLSKGLINKDISLVVLFESTEKTFLERFVNAYKEEAPQLIKLYQE 385 >ref|XP_013463290.1| mTERF protein [Medicago truncatula] gi|657397585|gb|KEH37301.1| mTERF protein [Medicago truncatula] Length = 417 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/58 (53%), Positives = 42/58 (72%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K I+PR V Q LL+KGL KKN L T F+Y EK+FL +FV F++E+ LLK+Y+E Sbjct: 340 EKRIIPRALVVQFLLMKGLRKKNASLGTPFAYSEKMFLSKFVFSFKEESDYLLKLYEE 397 >ref|XP_002274845.1| PREDICTED: uncharacterized protein LOC100252802 [Vitis vinifera] Length = 399 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K I+PR SV Q LL KGL+K + L LF EK+FL++FV F++EA +L+K+YQE Sbjct: 324 EKRIIPRYSVIQVLLSKGLIKNDTSLVVLFESTEKMFLRKFVNGFKEEAPQLMKLYQE 381 >emb|CAN77550.1| hypothetical protein VITISV_017394 [Vitis vinifera] Length = 188 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K I+PR SV Q LL KGL+K + L LF EK+FL++FV F++EA +L+K+YQE Sbjct: 113 EKRIIPRYSVIQVLLSKGLIKNDTSLVVLFESTEKMFLRKFVNGFKEEAPQLMKLYQE 170 >gb|KHN02984.1| hypothetical protein glysoja_009850 [Glycine soja] Length = 252 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K I PR V Q L+ K LL+K L+T F PEK+FLK+FVK F+++++ LLK+Y+E Sbjct: 182 QKRIAPRALVVQFLISKSLLQKEASLTTPFILPEKLFLKKFVKHFKEDSSHLLKLYEE 239 >ref|XP_002321027.2| hypothetical protein POPTR_0014s12770g [Populus trichocarpa] gi|550324082|gb|EEE99342.2| hypothetical protein POPTR_0014s12770g [Populus trichocarpa] Length = 400 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQ 260 +K I+PRC V Q L KGL+KK++ L+T+ EK FL+RFV +FE+E +LL VY+ Sbjct: 336 EKRIIPRCKVIQVLWSKGLIKKDISLNTVLLPVEKRFLERFVTKFEEEVPQLLSVYE 392 >ref|XP_011033588.1| PREDICTED: uncharacterized protein LOC105132030 [Populus euphratica] Length = 400 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/57 (49%), Positives = 41/57 (71%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQ 260 +K I+PRC V Q L KGL+KK++ L+T+ EK FL+RFV +FE+E +LL +Y+ Sbjct: 336 EKRIIPRCKVIQVLWSKGLIKKDISLNTVLLPVEKRFLERFVTKFEEEVPQLLNIYE 392 >ref|XP_007138895.1| hypothetical protein PHAVU_009G246600g [Phaseolus vulgaris] gi|561011982|gb|ESW10889.1| hypothetical protein PHAVU_009G246600g [Phaseolus vulgaris] Length = 386 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/58 (50%), Positives = 43/58 (74%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 ++ IVPR V + L++KGL +K+ +LST F E++FLK +V RF++E ELLK+YQE Sbjct: 313 ERRIVPRGLVLKHLIVKGLREKSAKLSTPFDVSEELFLKNYVMRFKEEVCELLKLYQE 370 >ref|XP_013463278.1| mTERF protein [Medicago truncatula] gi|657397574|gb|KEH37290.1| mTERF protein [Medicago truncatula] Length = 418 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = -1 Query: 427 KNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 K I+PR SV Q LL+KGL KKN L T F+Y EK+FL + V F++E+ LLK+Y+E Sbjct: 326 KRIIPRASVLQFLLMKGLRKKNASLVTPFTYSEKLFLSKCVLCFKEESDYLLKLYEE 382 >ref|XP_013463275.1| transcription termination factor family protein [Medicago truncatula] gi|657397571|gb|KEH37287.1| transcription termination factor family protein [Medicago truncatula] Length = 171 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/58 (48%), Positives = 41/58 (70%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K +PR + Q LL KGL K+ L++ F PEK+FL +F+KRFE E++ LLK+Y+E Sbjct: 100 EKRTIPRAPIVQFLLKKGLRKRTASLTSPFIVPEKLFLDKFIKRFENESSYLLKLYEE 157 >ref|XP_002276393.1| PREDICTED: uncharacterized protein LOC100240766 [Vitis vinifera] Length = 384 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K I+PR SV Q LL KGL+ K++ L LF EK+FL++FV +++EA +LL +YQE Sbjct: 321 EKRIIPRYSVVQVLLSKGLIDKDISLVVLFESTEKMFLEKFVNGYKEEAPQLLNLYQE 378 >emb|CAN78550.1| hypothetical protein VITISV_003242 [Vitis vinifera] Length = 384 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K I+PR SV Q LL KGL+ K++ L LF EK+FL++FV +++EA +LL +YQE Sbjct: 321 EKRIIPRYSVVQVLLSKGLIDKDISLVVLFESTEKMFLEKFVNGYKEEAPQLLNLYQE 378 >ref|XP_009361990.1| PREDICTED: uncharacterized protein LOC103952167 [Pyrus x bretschneideri] Length = 461 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 2/59 (3%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKK--NVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQ 260 +K I+PRCSV + LL+KGL+K+ NV L +L SY EK FL+RFV R+ E LL VY+ Sbjct: 329 EKRIIPRCSVVKVLLLKGLIKEIENVSLCSLMSYTEKGFLERFVARYIDEVPGLLSVYR 387 >ref|XP_013463282.1| mTERF protein [Medicago truncatula] gi|657397578|gb|KEH37294.1| mTERF protein [Medicago truncatula] Length = 320 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -1 Query: 430 KKNIVPRCSVHQALLIKGLLKKNVRLSTLFSYPEKIFLKRFVKRFEKEAAELLKVYQE 257 +K IVPR V Q LL+KGL KKN L T F Y EK+FL++FV F++E+ LLK+Y+E Sbjct: 246 EKWIVPRGLVVQFLLMKGLRKKNASLVTPFRYSEKLFLEKFVFSFKEESDYLLKIYEE 303