BLASTX nr result
ID: Gardenia21_contig00032740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032740 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078929.1| PREDICTED: uncharacterized protein LOC105162... 57 4e-06 ref|XP_007022724.1| RNA-directed DNA polymerase [Theobroma cacao... 57 4e-06 gb|KNA14637.1| hypothetical protein SOVF_105670 [Spinacia oleracea] 56 9e-06 >ref|XP_011078929.1| PREDICTED: uncharacterized protein LOC105162568 [Sesamum indicum] Length = 773 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 265 KCISLCSEHISELYMGRLTLQDIDCTSFVD 176 KC+ LCS+HISELYMGRLTLQDIDCT D Sbjct: 742 KCVPLCSDHISELYMGRLTLQDIDCTDLAD 771 >ref|XP_007022724.1| RNA-directed DNA polymerase [Theobroma cacao] gi|508722352|gb|EOY14249.1| RNA-directed DNA polymerase [Theobroma cacao] Length = 750 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/30 (73%), Positives = 30/30 (100%) Frame = -2 Query: 265 KCISLCSEHISELYMGRLTLQDIDCTSFVD 176 KC+SLC++HI++LYMG++TLQDIDCTSFV+ Sbjct: 719 KCLSLCADHINDLYMGKITLQDIDCTSFVE 748 >gb|KNA14637.1| hypothetical protein SOVF_105670 [Spinacia oleracea] Length = 762 Score = 56.2 bits (134), Expect = 9e-06 Identities = 21/30 (70%), Positives = 29/30 (96%) Frame = -2 Query: 265 KCISLCSEHISELYMGRLTLQDIDCTSFVD 176 +C +LC++H+S+LYMGR+TLQDIDCTSFV+ Sbjct: 731 RCFALCADHVSDLYMGRITLQDIDCTSFVE 760