BLASTX nr result
ID: Gardenia21_contig00032696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032696 (253 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99174.1| unnamed protein product [Coffea canephora] 62 2e-07 emb|CDP19398.1| unnamed protein product [Coffea canephora] 61 3e-07 >emb|CDO99174.1| unnamed protein product [Coffea canephora] Length = 798 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 135 RTLRDISRKQMGLDWMLRPKDTNIMEKTPAAALDKQREV 251 + LRDISRK+MGLDWMLRPKDT MEKTP ALD Q+EV Sbjct: 183 QNLRDISRKEMGLDWMLRPKDT--MEKTPGTALDNQQEV 219 >emb|CDP19398.1| unnamed protein product [Coffea canephora] Length = 630 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 135 RTLRDISRKQMGLDWMLRPKDTNIMEKTPAAALDKQREV 251 + LRDISRK+MGLDWMLRPKDT MEKTPA DKQ+EV Sbjct: 23 QNLRDISRKEMGLDWMLRPKDT--MEKTPATVSDKQQEV 59