BLASTX nr result
ID: Gardenia21_contig00032634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032634 (440 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 55 4e-15 gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] 75 2e-11 gb|KJB09779.1| hypothetical protein B456_001G164700, partial [Go... 57 5e-06 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 55.1 bits (131), Expect(2) = 4e-15 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 3 RYRTCDSHRIRLAQRLLNPSQAFSFTSPI 89 RYRTCDSHRIRLAQRLLNPS+AFS T P+ Sbjct: 31 RYRTCDSHRIRLAQRLLNPSRAFSSTFPL 59 Score = 52.8 bits (125), Expect(2) = 4e-15 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 128 GVFPSPILCIGLASSRTKEAFRRTHACRKADDYIS 232 GVFPSPI+CIGLASSR+K + R ACRKAD YIS Sbjct: 74 GVFPSPIVCIGLASSRSK-LYLRARACRKADHYIS 107 >gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] Length = 190 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 195 RRNASLVRDEAKPIHRIGEGKTPHFIAPGERKFDRGLER 79 R+NASLVRDEAKP + IGEGKTPHFIAPGERKFDRGLER Sbjct: 82 RQNASLVRDEAKPKYTIGEGKTPHFIAPGERKFDRGLER 120 >gb|KJB09779.1| hypothetical protein B456_001G164700, partial [Gossypium raimondii] Length = 231 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 129 GSFLRLSYVSAWLRPEPRRHSGGRMR 206 GSFLRLSYVSAWLRPEPRRHSGGR+R Sbjct: 156 GSFLRLSYVSAWLRPEPRRHSGGRVR 181