BLASTX nr result
ID: Gardenia21_contig00032607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032607 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11224.1| unnamed protein product [Coffea canephora] 65 2e-15 >emb|CDP11224.1| unnamed protein product [Coffea canephora] Length = 356 Score = 65.1 bits (157), Expect(2) = 2e-15 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -2 Query: 343 GSKIWPINLSQHWFGEGWQEFCCSNIVKENDVFLLRQCGNLIFDVIHFSKYKKK 182 G + W I ++ H F EGW FC NIVK +D LLR GNLIFDVIHF + +K+ Sbjct: 149 GLRQWTITVTDHSFEEGWDAFCEHNIVKRHDTLLLRHSGNLIFDVIHFCELQKQ 202 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = -1 Query: 167 WTDPLPYILHLQSCA---DFETSSGQRLTPQQVSSLMKPDFIQNLTGNLCLYQV 15 WT PLP +LH+ A D T + Q QQV+S ++P+F Q+L+ ++C YQ+ Sbjct: 207 WTVPLPDLLHMNVAASRDDIHTPTRQ----QQVASSLRPNFCQDLSDSICFYQI 256