BLASTX nr result
ID: Gardenia21_contig00032588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032588 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00174.1| unnamed protein product [Coffea canephora] 100 4e-19 >emb|CDP00174.1| unnamed protein product [Coffea canephora] Length = 2173 Score = 100 bits (249), Expect = 4e-19 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -1 Query: 155 MDGKFGGFVIDLNETPLSSPRETILDDNDDVVITERPPAPAAGLVEVGKRS 3 MDGKFGGFVIDLNETPLSSPRETILDDNDDVVI ERPPAPA GLVEVGKR+ Sbjct: 1 MDGKFGGFVIDLNETPLSSPRETILDDNDDVVIIERPPAPAVGLVEVGKRN 51