BLASTX nr result
ID: Gardenia21_contig00032581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032581 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05175.1| unnamed protein product [Coffea canephora] 96 1e-17 >emb|CDP05175.1| unnamed protein product [Coffea canephora] Length = 251 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -1 Query: 164 MSGGVGPSSDIRLPTEEEDEIHHQKTSFPEEGGTQSQKPPQPPRRGFFTFQQLN 3 MSGGVGPSSDIRLP EEE EIH +K SFP+EGGTQSQKPPQP RRGFFTF+QLN Sbjct: 1 MSGGVGPSSDIRLPKEEE-EIHQRKASFPKEGGTQSQKPPQPSRRGFFTFRQLN 53