BLASTX nr result
ID: Gardenia21_contig00032386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032386 (273 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07366.1| unnamed protein product [Coffea canephora] 51 4e-06 >emb|CDP07366.1| unnamed protein product [Coffea canephora] Length = 423 Score = 51.2 bits (121), Expect(2) = 4e-06 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = -3 Query: 199 MEPVA---DKLKEFTKFTQDLFTHGILHWHQNFSRRNPV 92 MEPVA DKLK+F K +Q+L GIL W QNF+RRNP+ Sbjct: 1 MEPVASVVDKLKDFAKSSQELLARGILRWPQNFNRRNPI 39 Score = 26.2 bits (56), Expect(2) = 4e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 38 IEILKRLQREAF 3 IEILKRLQREAF Sbjct: 39 IEILKRLQREAF 50