BLASTX nr result
ID: Gardenia21_contig00032229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032229 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04646.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP04646.1| unnamed protein product [Coffea canephora] Length = 498 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/62 (51%), Positives = 41/62 (66%) Frame = +2 Query: 2 VLEQYQIYGDSVLGKYGQKPSVRDIVKV*ILLMFHPNNIGQPQGSCIPFSFETCYTTCKI 181 VLEQYQIYGDSVLGKYGQKPSVRD+VK +L +FH + +F+ C T + Sbjct: 391 VLEQYQIYGDSVLGKYGQKPSVRDVVKP-LLGLFHSEPGNALWKRNVDSAFQHCTTIKSL 449 Query: 182 VD 187 ++ Sbjct: 450 LE 451