BLASTX nr result
ID: Gardenia21_contig00032113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032113 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18591.1| unnamed protein product [Coffea canephora] 144 2e-32 ref|XP_009768660.1| PREDICTED: pentatricopeptide repeat-containi... 135 1e-29 ref|XP_009607936.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_006356525.1| PREDICTED: pentatricopeptide repeat-containi... 132 8e-29 ref|XP_010322786.1| PREDICTED: pentatricopeptide repeat-containi... 132 1e-28 ref|XP_014504879.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 ref|XP_014504872.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 ref|XP_011653842.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 gb|KGN54664.1| hypothetical protein Csa_4G418570 [Cucumis sativus] 131 2e-28 ref|XP_004304914.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 ref|XP_008240989.1| PREDICTED: pentatricopeptide repeat-containi... 130 3e-28 gb|KHN29477.1| Pentatricopeptide repeat-containing protein, mito... 130 4e-28 ref|XP_008455763.1| PREDICTED: pentatricopeptide repeat-containi... 130 4e-28 ref|XP_007140043.1| hypothetical protein PHAVU_008G079600g [Phas... 130 4e-28 ref|XP_007204168.1| hypothetical protein PRUPE_ppa017537mg [Prun... 130 4e-28 ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containi... 130 4e-28 ref|XP_012088850.1| PREDICTED: pentatricopeptide repeat-containi... 130 5e-28 gb|KDP23356.1| hypothetical protein JCGZ_23189 [Jatropha curcas] 130 5e-28 ref|XP_008378953.1| PREDICTED: pentatricopeptide repeat-containi... 129 6e-28 ref|XP_010070071.1| PREDICTED: pentatricopeptide repeat-containi... 129 6e-28 >emb|CDP18591.1| unnamed protein product [Coffea canephora] Length = 705 Score = 144 bits (364), Expect = 2e-32 Identities = 67/68 (98%), Positives = 68/68 (100%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHF+DG Sbjct: 638 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFEDG 697 Query: 181 VCSCNDYW 204 VCSCNDYW Sbjct: 698 VCSCNDYW 705 >ref|XP_009768660.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Nicotiana sylvestris] gi|698549458|ref|XP_009768661.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Nicotiana sylvestris] Length = 704 Score = 135 bits (340), Expect = 1e-29 Identities = 63/68 (92%), Positives = 64/68 (94%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLKLP GMPIRVMKNLRVCGDCH AIKLISKVTGR IILRDANRFHHFKDG Sbjct: 637 SEKLAVAYGLLKLPEGMPIRVMKNLRVCGDCHSAIKLISKVTGREIILRDANRFHHFKDG 696 Query: 181 VCSCNDYW 204 VCSC DYW Sbjct: 697 VCSCRDYW 704 >ref|XP_009607936.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Nicotiana tomentosiformis] Length = 704 Score = 134 bits (338), Expect = 2e-29 Identities = 62/68 (91%), Positives = 64/68 (94%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGL+KLP GMPIRVMKNLRVCGDCH AIKLISKVTGR IILRDANRFHHFKDG Sbjct: 637 SEKLAVAYGLMKLPEGMPIRVMKNLRVCGDCHSAIKLISKVTGREIILRDANRFHHFKDG 696 Query: 181 VCSCNDYW 204 VCSC DYW Sbjct: 697 VCSCRDYW 704 >ref|XP_006356525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Solanum tuberosum] Length = 704 Score = 132 bits (333), Expect = 8e-29 Identities = 61/68 (89%), Positives = 64/68 (94%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLKLP GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 637 SEKLAVAYGLLKLPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDG 696 Query: 181 VCSCNDYW 204 VCSC D+W Sbjct: 697 VCSCKDFW 704 >ref|XP_010322786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Solanum lycopersicum] Length = 704 Score = 132 bits (332), Expect = 1e-28 Identities = 60/68 (88%), Positives = 64/68 (94%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLKLP GMPIR+MKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 637 SEKLAVAYGLLKLPQGMPIRIMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDG 696 Query: 181 VCSCNDYW 204 VCSC D+W Sbjct: 697 VCSCKDFW 704 >ref|XP_014504879.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like isoform X2 [Vigna radiata var. radiata] Length = 709 Score = 131 bits (329), Expect = 2e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 642 SEKLAVAYGLLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDG 701 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 702 YCSCKDYW 709 >ref|XP_014504872.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like isoform X1 [Vigna radiata var. radiata] gi|950993309|ref|XP_014504873.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like isoform X1 [Vigna radiata var. radiata] gi|950993315|ref|XP_014504874.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like isoform X1 [Vigna radiata var. radiata] gi|950993320|ref|XP_014504875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like isoform X1 [Vigna radiata var. radiata] gi|950993325|ref|XP_014504876.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like isoform X1 [Vigna radiata var. radiata] gi|950993330|ref|XP_014504877.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like isoform X1 [Vigna radiata var. radiata] gi|950993334|ref|XP_014504878.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like isoform X1 [Vigna radiata var. radiata] Length = 710 Score = 131 bits (329), Expect = 2e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 643 SEKLAVAYGLLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDG 702 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 703 YCSCKDYW 710 >ref|XP_011653842.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Cucumis sativus] Length = 708 Score = 131 bits (329), Expect = 2e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 641 SEKLAVAYGLLKIPIGMPIRVMKNLRVCGDCHAAIKLIAKVTGREIILRDANRFHHFKDG 700 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 701 SCSCRDYW 708 >gb|KGN54664.1| hypothetical protein Csa_4G418570 [Cucumis sativus] Length = 774 Score = 131 bits (329), Expect = 2e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 707 SEKLAVAYGLLKIPIGMPIRVMKNLRVCGDCHAAIKLIAKVTGREIILRDANRFHHFKDG 766 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 767 SCSCRDYW 774 >ref|XP_004304914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 703 Score = 131 bits (329), Expect = 2e-28 Identities = 60/68 (88%), Positives = 64/68 (94%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLAIAYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR II+RDANRFHHFKDG Sbjct: 636 SEKLAIAYGLLKVPQGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIIVRDANRFHHFKDG 695 Query: 181 VCSCNDYW 204 +CSC DYW Sbjct: 696 LCSCRDYW 703 >ref|XP_008240989.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Prunus mume] Length = 703 Score = 130 bits (328), Expect = 3e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLAIAYGLLK+P GMPIRVMKNLRVCGDCH AIKLISKV GR +ILRDANRFHHFKDG Sbjct: 636 SEKLAIAYGLLKVPQGMPIRVMKNLRVCGDCHSAIKLISKVMGREVILRDANRFHHFKDG 695 Query: 181 VCSCNDYW 204 +CSC DYW Sbjct: 696 LCSCGDYW 703 >gb|KHN29477.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 476 Score = 130 bits (327), Expect = 4e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 409 SEKLAVAYGLLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDG 468 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 469 HCSCKDYW 476 >ref|XP_008455763.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Cucumis melo] Length = 708 Score = 130 bits (327), Expect = 4e-28 Identities = 59/68 (86%), Positives = 62/68 (91%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGL K+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 641 SEKLAVAYGLFKIPKGMPIRVMKNLRVCGDCHAAIKLIAKVTGREIILRDANRFHHFKDG 700 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 701 SCSCQDYW 708 >ref|XP_007140043.1| hypothetical protein PHAVU_008G079600g [Phaseolus vulgaris] gi|561013176|gb|ESW12037.1| hypothetical protein PHAVU_008G079600g [Phaseolus vulgaris] Length = 709 Score = 130 bits (327), Expect = 4e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 642 SEKLAVAYGLLKVPKGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDG 701 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 702 HCSCKDYW 709 >ref|XP_007204168.1| hypothetical protein PRUPE_ppa017537mg [Prunus persica] gi|462399699|gb|EMJ05367.1| hypothetical protein PRUPE_ppa017537mg [Prunus persica] Length = 631 Score = 130 bits (327), Expect = 4e-28 Identities = 59/68 (86%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLAIAYGLLK+P GMPIRVMKNLR+CGDCH AIKLISKV GR +ILRDANRFHHFKDG Sbjct: 564 SEKLAIAYGLLKVPQGMPIRVMKNLRICGDCHSAIKLISKVMGREVILRDANRFHHFKDG 623 Query: 181 VCSCNDYW 204 +CSC DYW Sbjct: 624 LCSCRDYW 631 >ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Glycine max] gi|947091980|gb|KRH40645.1| hypothetical protein GLYMA_09G272000 [Glycine max] Length = 711 Score = 130 bits (327), Expect = 4e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 644 SEKLAVAYGLLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDG 703 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 704 HCSCKDYW 711 >ref|XP_012088850.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial [Jatropha curcas] Length = 704 Score = 130 bits (326), Expect = 5e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLKLP GMPIRVMKNLRVCGDCH AIKLI+KVT R IILRDANRFHHFKDG Sbjct: 637 SEKLAVAYGLLKLPEGMPIRVMKNLRVCGDCHSAIKLIAKVTRREIILRDANRFHHFKDG 696 Query: 181 VCSCNDYW 204 +CSC DYW Sbjct: 697 LCSCRDYW 704 >gb|KDP23356.1| hypothetical protein JCGZ_23189 [Jatropha curcas] Length = 631 Score = 130 bits (326), Expect = 5e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+AYGLLKLP GMPIRVMKNLRVCGDCH AIKLI+KVT R IILRDANRFHHFKDG Sbjct: 564 SEKLAVAYGLLKLPEGMPIRVMKNLRVCGDCHSAIKLIAKVTRREIILRDANRFHHFKDG 623 Query: 181 VCSCNDYW 204 +CSC DYW Sbjct: 624 LCSCRDYW 631 >ref|XP_008378953.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Malus domestica] Length = 703 Score = 129 bits (325), Expect = 6e-28 Identities = 60/68 (88%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLAIAYGLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVT R I+LRDANRFHHFKDG Sbjct: 636 SEKLAIAYGLLKVPKGMPIRVMKNLRVCGDCHSAIKLIAKVTQREIVLRDANRFHHFKDG 695 Query: 181 VCSCNDYW 204 VCSC DYW Sbjct: 696 VCSCXDYW 703 >ref|XP_010070071.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Eucalyptus grandis] gi|702436311|ref|XP_010070072.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Eucalyptus grandis] gi|702436315|ref|XP_010070073.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Eucalyptus grandis] gi|629092647|gb|KCW58642.1| hypothetical protein EUGRSUZ_H01305 [Eucalyptus grandis] Length = 705 Score = 129 bits (325), Expect = 6e-28 Identities = 59/68 (86%), Positives = 63/68 (92%) Frame = +1 Query: 1 SEKLAIAYGLLKLPGGMPIRVMKNLRVCGDCHVAIKLISKVTGRLIILRDANRFHHFKDG 180 SEKLA+A+GLLK+P GMPIRVMKNLRVCGDCH AIKLI+KVTGR IILRDANRFHHFKDG Sbjct: 638 SEKLAVAFGLLKIPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDG 697 Query: 181 VCSCNDYW 204 CSC DYW Sbjct: 698 SCSCRDYW 705