BLASTX nr result
ID: Gardenia21_contig00032109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00032109 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02594.1| unnamed protein product [Coffea canephora] 60 5e-07 >emb|CDP02594.1| unnamed protein product [Coffea canephora] Length = 897 Score = 60.5 bits (145), Expect = 5e-07 Identities = 34/61 (55%), Positives = 37/61 (60%) Frame = -3 Query: 185 MNAQRTSIFLTLTLIASFTPQSTKTSAAGPAGRDFIAHQKPRRILHQPLYPATSAPPPES 6 MNA+R SIFLTLTLIASFT Q RILHQPLYP T+APPPES Sbjct: 1 MNARRISIFLTLTLIASFTTQ---------------------RILHQPLYPVTAAPPPES 39 Query: 5 I 3 + Sbjct: 40 V 40