BLASTX nr result
ID: Gardenia21_contig00031881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00031881 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08954.1| unnamed protein product [Coffea canephora] 82 2e-13 >emb|CDP08954.1| unnamed protein product [Coffea canephora] Length = 71 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 124 LPPRRGQIKMKIFKSIAGIVTKANGSKRKNAGPLSSTSTTP 2 LPPRRGQIKMKIFKSIAGIVTKA+GSKRKNAGPLSSTSTTP Sbjct: 16 LPPRRGQIKMKIFKSIAGIVTKASGSKRKNAGPLSSTSTTP 56