BLASTX nr result
ID: Gardenia21_contig00030892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030892 (334 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97115.1| unnamed protein product [Coffea canephora] 200 3e-49 ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containi... 152 1e-34 ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containi... 149 1e-33 ref|XP_009613228.1| PREDICTED: pentatricopeptide repeat-containi... 139 8e-31 ref|XP_009769334.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 134 2e-29 ref|XP_009769332.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_002269015.2| PREDICTED: pentatricopeptide repeat-containi... 124 4e-26 emb|CBI20053.3| unnamed protein product [Vitis vinifera] 124 4e-26 ref|XP_002519129.1| pentatricopeptide repeat-containing protein,... 116 6e-24 ref|XP_012069241.1| PREDICTED: pentatricopeptide repeat-containi... 116 8e-24 ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein... 115 1e-23 ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily p... 115 1e-23 ref|XP_007201524.1| hypothetical protein PRUPE_ppa015625mg, part... 113 6e-23 ref|XP_008237676.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_010105594.1| hypothetical protein L484_003967 [Morus nota... 110 3e-22 gb|KNA24646.1| hypothetical protein SOVF_013730 [Spinacia oleracea] 109 9e-22 ref|XP_012436499.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_010257564.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_010257551.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_010690978.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 >emb|CDO97115.1| unnamed protein product [Coffea canephora] Length = 647 Score = 200 bits (509), Expect = 3e-49 Identities = 102/111 (91%), Positives = 103/111 (92%) Frame = -1 Query: 334 SSQCLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSS 155 S QCLNLECYCLAISILSRRPSPKQATELIKTVICSRIA SDIFYGLV RERLKI SS Sbjct: 105 SPQCLNLECYCLAISILSRRPSPKQATELIKTVICSRIARISDIFYGLVGARERLKISSS 164 Query: 154 ILLDLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 ILLDLLIRALCELKK D AFECFKMMQGMNVLPKIETCNDILSLFLKL+RT Sbjct: 165 ILLDLLIRALCELKKGDEAFECFKMMQGMNVLPKIETCNDILSLFLKLNRT 215 >ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Solanum lycopersicum] Length = 618 Score = 152 bits (383), Expect = 1e-34 Identities = 72/108 (66%), Positives = 90/108 (83%) Frame = -1 Query: 325 CLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILL 146 CL++ CYCLAISILSR PSPKQAT L+K VI SR AS ++IFYGLV+ RE+L + SSI+L Sbjct: 84 CLDISCYCLAISILSRLPSPKQATHLLKQVISSRFASPNEIFYGLVSAREKLVVKSSIVL 143 Query: 145 DLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 DLL+RA CELKK + A +CF +M+ +LPK+ETCND+LSLFLKL+RT Sbjct: 144 DLLVRAYCELKKGEDALKCFYLMKQKGILPKVETCNDLLSLFLKLNRT 191 >ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum tuberosum] Length = 618 Score = 149 bits (375), Expect = 1e-33 Identities = 72/111 (64%), Positives = 91/111 (81%) Frame = -1 Query: 334 SSQCLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSS 155 S CL++ CYCLAISILSR PSPKQAT L+K VI R+AS ++IF GLV+ RE+L+I SS Sbjct: 81 SPNCLDISCYCLAISILSRLPSPKQATHLLKQVISYRLASHNEIFDGLVSAREKLEIKSS 140 Query: 154 ILLDLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 I+LDLL+RA CELKK + A +CF +M+ +LPK+ETCND+LSLFLKL+RT Sbjct: 141 IVLDLLVRAYCELKKGEDALKCFYLMKQKGILPKVETCNDLLSLFLKLNRT 191 >ref|XP_009613228.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Nicotiana tomentosiformis] Length = 629 Score = 139 bits (350), Expect = 8e-31 Identities = 68/111 (61%), Positives = 87/111 (78%) Frame = -1 Query: 334 SSQCLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSS 155 S CL++ CY LAISILSR PSPKQA L+K VI +R+A+ + F GLV+ RE+L+I SS Sbjct: 92 SPNCLDITCYSLAISILSRLPSPKQAAHLLKRVISARVATHKEFFDGLVSAREKLEIKSS 151 Query: 154 ILLDLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 I+LDLL+RA CELKK + A +CF +M+ +LPKIETCND+LSLF KL+RT Sbjct: 152 IVLDLLVRAYCELKKGEEALKCFYLMKQKGILPKIETCNDLLSLFNKLNRT 202 >ref|XP_009769334.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Nicotiana sylvestris] Length = 629 Score = 134 bits (338), Expect = 2e-29 Identities = 64/111 (57%), Positives = 86/111 (77%) Frame = -1 Query: 334 SSQCLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSS 155 S CL++ CY L I ILSR PSPK+AT+L+K VI +R+ + + F GLV+ RE+L+I SS Sbjct: 92 SPNCLDITCYSLVICILSRLPSPKEATQLLKQVISARVVTHKEFFDGLVSAREKLEIKSS 151 Query: 154 ILLDLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 I+LDLL+RA CELKK + A +CF +++ +LPKIETCND+LSLF KL+RT Sbjct: 152 IVLDLLVRAYCELKKGEEALKCFYLLKQKGILPKIETCNDLLSLFNKLNRT 202 >ref|XP_009769332.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Nicotiana sylvestris] Length = 629 Score = 134 bits (338), Expect = 2e-29 Identities = 64/111 (57%), Positives = 86/111 (77%) Frame = -1 Query: 334 SSQCLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSS 155 S CL++ CY L I ILSR PSPK+AT+L+K VI +R+ + + F GLV+ RE+L+I SS Sbjct: 92 SPNCLDITCYSLVICILSRLPSPKEATQLLKQVISARVVTHKEFFDGLVSAREKLEIKSS 151 Query: 154 ILLDLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 I+LDLL+RA CELKK + A +CF +++ +LPKIETCND+LSLF KL+RT Sbjct: 152 IVLDLLVRAYCELKKGEEALKCFYLLKQKGILPKIETCNDLLSLFNKLNRT 202 >ref|XP_002269015.2| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Vitis vinifera] Length = 660 Score = 124 bits (310), Expect = 4e-26 Identities = 58/107 (54%), Positives = 82/107 (76%) Frame = -1 Query: 325 CLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILL 146 CL+ + YCLA+ +L+R PSPK A +L+K V+ +RIA+ ++F L R+RL + SSI+ Sbjct: 127 CLDTKSYCLAVVLLARLPSPKLALQLLKQVMGTRIATNRELFDELTLSRDRLSVKSSIVF 186 Query: 145 DLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDR 5 DLL+R CEL++AD AF+CF MM+ ++PKIETCND+LSLFLKL+R Sbjct: 187 DLLVRVCCELRRADEAFKCFYMMKEKGIVPKIETCNDMLSLFLKLNR 233 >emb|CBI20053.3| unnamed protein product [Vitis vinifera] Length = 634 Score = 124 bits (310), Expect = 4e-26 Identities = 58/107 (54%), Positives = 82/107 (76%) Frame = -1 Query: 325 CLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILL 146 CL+ + YCLA+ +L+R PSPK A +L+K V+ +RIA+ ++F L R+RL + SSI+ Sbjct: 101 CLDTKSYCLAVVLLARLPSPKLALQLLKQVMGTRIATNRELFDELTLSRDRLSVKSSIVF 160 Query: 145 DLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDR 5 DLL+R CEL++AD AF+CF MM+ ++PKIETCND+LSLFLKL+R Sbjct: 161 DLLVRVCCELRRADEAFKCFYMMKEKGIVPKIETCNDMLSLFLKLNR 207 >ref|XP_002519129.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541792|gb|EEF43340.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 643 Score = 116 bits (291), Expect = 6e-24 Identities = 57/107 (53%), Positives = 77/107 (71%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L+++ CLA++++SR PSPK L+K I SR+A D+F+ L R+RL SSI+ D Sbjct: 111 LDIKTKCLAVAVVSRSPSPKSTLHLLKQTIESRVAGVKDVFHELAITRDRLGTKSSIVFD 170 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 +LIRA CELK+ D AFECF MM+ V+PKIET N +LSLFLKL++T Sbjct: 171 MLIRACCELKRGDDAFECFDMMKEKGVVPKIETFNAMLSLFLKLNQT 217 >ref|XP_012069241.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Jatropha curcas] gi|643740596|gb|KDP46186.1| hypothetical protein JCGZ_10026 [Jatropha curcas] Length = 649 Score = 116 bits (290), Expect = 8e-24 Identities = 57/107 (53%), Positives = 77/107 (71%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L+++ CLAI+++S PSPK + +L+K I S IA+ D+F L + ++L SSIL D Sbjct: 117 LDIKTKCLAIAVISPSPSPKASLQLLKQTISSNIATVEDVFNELESALDQLNTKSSILFD 176 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 LLIRA CE+K+ D AF CF MM+ +PKIETCND+LSLFLKL+RT Sbjct: 177 LLIRACCEMKRGDNAFMCFDMMKKKGTVPKIETCNDMLSLFLKLNRT 223 >ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] gi|508705300|gb|EOX97196.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] Length = 494 Score = 115 bits (288), Expect = 1e-23 Identities = 59/109 (54%), Positives = 77/109 (70%) Frame = -1 Query: 328 QCLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSIL 149 Q L+++ CLAI++ SR PSPK +L+K I S IAS + IF L R+RL I ++IL Sbjct: 115 QRLDVKTRCLAIAVASRLPSPKPTLQLLKQTIYSDIASVTVIFDELALARDRLGISTTIL 174 Query: 148 LDLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 DLLIRA CE+K+ D ECF MM+ ++PKIETCND+LS FLKL+RT Sbjct: 175 FDLLIRACCEMKRVDEGLECFYMMKDKGLIPKIETCNDMLSTFLKLNRT 223 >ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682507|ref|XP_007041361.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682510|ref|XP_007041362.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682513|ref|XP_007041363.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682516|ref|XP_007041364.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682524|ref|XP_007041366.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705295|gb|EOX97191.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705296|gb|EOX97192.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705297|gb|EOX97193.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705298|gb|EOX97194.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705299|gb|EOX97195.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705301|gb|EOX97197.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 650 Score = 115 bits (288), Expect = 1e-23 Identities = 59/109 (54%), Positives = 77/109 (70%) Frame = -1 Query: 328 QCLNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSIL 149 Q L+++ CLAI++ SR PSPK +L+K I S IAS + IF L R+RL I ++IL Sbjct: 115 QRLDVKTRCLAIAVASRLPSPKPTLQLLKQTIYSDIASVTVIFDELALARDRLGISTTIL 174 Query: 148 LDLLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 DLLIRA CE+K+ D ECF MM+ ++PKIETCND+LS FLKL+RT Sbjct: 175 FDLLIRACCEMKRVDEGLECFYMMKDKGLIPKIETCNDMLSTFLKLNRT 223 >ref|XP_007201524.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica] gi|462396924|gb|EMJ02723.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica] Length = 545 Score = 113 bits (282), Expect = 6e-23 Identities = 55/107 (51%), Positives = 79/107 (73%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L+++ CLAI+I++R+ SP+ A EL+K V+ S IA+ ++F L R+RL + SSI+ D Sbjct: 42 LDIQTRCLAIAIVARQSSPQPALELLKQVVGSGIATIREVFNPLALSRDRLSVNSSIIFD 101 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 LL+RA CE+KKAD A +CF +M +PK ETCND+LSLFLKL++T Sbjct: 102 LLLRACCEMKKADEAVDCFYLMVDKGFMPKTETCNDMLSLFLKLNQT 148 >ref|XP_008237676.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Prunus mume] Length = 630 Score = 112 bits (280), Expect = 1e-22 Identities = 56/107 (52%), Positives = 78/107 (72%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L+++ CLAI+I++R+ SP+ A EL+K V+ S IA+ +IF L RE L + SSI+ D Sbjct: 98 LDIQTRCLAIAIVARQSSPQPAFELLKQVVGSGIATIREIFNPLALSREHLSVNSSIIFD 157 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 LL+RA CE+KKAD A +CF +M +PK ETCND+LSLFLKL++T Sbjct: 158 LLLRACCEMKKADEAVDCFYLMVDKGFMPKTETCNDMLSLFLKLNQT 204 >ref|XP_010105594.1| hypothetical protein L484_003967 [Morus notabilis] gi|587917601|gb|EXC05161.1| hypothetical protein L484_003967 [Morus notabilis] Length = 634 Score = 110 bits (276), Expect = 3e-22 Identities = 58/103 (56%), Positives = 71/103 (68%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 LN+E CLA +IL+ PSPK A L+K + IAST +IF L RERL I S+++ D Sbjct: 102 LNVESLCLATTILAPIPSPKTALHLLKRAVNGGIASTREIFEELERARERLSIESAVVFD 161 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLK 14 LIRA CEL KA AFECF +M+ V+PKIETCND+LSLF K Sbjct: 162 FLIRACCELNKAKEAFECFWIMKEKGVVPKIETCNDMLSLFSK 204 >gb|KNA24646.1| hypothetical protein SOVF_013730 [Spinacia oleracea] Length = 642 Score = 109 bits (272), Expect = 9e-22 Identities = 55/107 (51%), Positives = 75/107 (70%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L+ + LA+ I+S PSPK A +L K +I SR+ ++SD F L RE+L + SI D Sbjct: 91 LDADSNSLALVIVSLLPSPKSAVQLAKRIINSRLVTSSDFFTKLGKSREKLNVEISICYD 150 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 IR LC+LKKA+ AF+CFKMM+ + VLPK+ETCND+LSLFL+ + T Sbjct: 151 YWIRGLCQLKKAEEAFKCFKMMKDLGVLPKVETCNDMLSLFLRFNYT 197 >ref|XP_012436499.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Gossypium raimondii] gi|763780763|gb|KJB47834.1| hypothetical protein B456_008G044300 [Gossypium raimondii] Length = 631 Score = 108 bits (269), Expect = 2e-21 Identities = 53/107 (49%), Positives = 72/107 (67%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L+++ CLAI++ SR PSPK L+K + S IA + +F L RERL I +++L D Sbjct: 98 LDIKTRCLAIAVASRLPSPKPTLNLLKRTVSSDIAGVAVVFDELALARERLGISTTLLFD 157 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDRT 2 LLI+A CE+K+ D ECF MM+ +PKIETCN +LS FLKL+RT Sbjct: 158 LLIKACCEMKRVDEGLECFYMMKDKGFIPKIETCNALLSTFLKLNRT 204 >ref|XP_010257564.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X2 [Nelumbo nucifera] Length = 616 Score = 107 bits (267), Expect = 4e-21 Identities = 54/106 (50%), Positives = 74/106 (69%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L+L+C CLA+ I SR PS + A +L+K + IA+ +IF L+ V ERL + SS++ D Sbjct: 114 LDLQCVCLAVGISSRNPSSQPALQLMKRAVDGGIATHWEIFDELLLVHERLNLSSSVVFD 173 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDR 5 LL+RA LK+ AFECF MM+ +LPKIETCND+LSL LKL++ Sbjct: 174 LLMRAFSGLKRPGEAFECFYMMKDRGILPKIETCNDLLSLLLKLNQ 219 >ref|XP_010257551.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005116|ref|XP_010257552.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005119|ref|XP_010257553.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005123|ref|XP_010257554.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005126|ref|XP_010257555.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005129|ref|XP_010257556.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005132|ref|XP_010257557.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005135|ref|XP_010257558.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005138|ref|XP_010257559.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005142|ref|XP_010257560.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005145|ref|XP_010257561.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005148|ref|XP_010257562.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] gi|720005151|ref|XP_010257563.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial isoform X1 [Nelumbo nucifera] Length = 646 Score = 107 bits (267), Expect = 4e-21 Identities = 54/106 (50%), Positives = 74/106 (69%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L+L+C CLA+ I SR PS + A +L+K + IA+ +IF L+ V ERL + SS++ D Sbjct: 114 LDLQCVCLAVGISSRNPSSQPALQLMKRAVDGGIATHWEIFDELLLVHERLNLSSSVVFD 173 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLDR 5 LL+RA LK+ AFECF MM+ +LPKIETCND+LSL LKL++ Sbjct: 174 LLMRAFSGLKRPGEAFECFYMMKDRGILPKIETCNDLLSLLLKLNQ 219 >ref|XP_010690978.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731358866|ref|XP_010690979.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870848244|gb|KMT00533.1| hypothetical protein BVRB_9g218310 [Beta vulgaris subsp. vulgaris] Length = 631 Score = 106 bits (264), Expect = 8e-21 Identities = 51/105 (48%), Positives = 74/105 (70%) Frame = -1 Query: 322 LNLECYCLAISILSRRPSPKQATELIKTVICSRIASTSDIFYGLVTVRERLKIPSSILLD 143 L++ LA+ I+S PSPK A +L K +I S++ S+S+ F L RE L + S+I D Sbjct: 99 LDIHSNSLALVIISLLPSPKPALQLAKYIISSKLVSSSEFFSKLGQARESLNVDSTICFD 158 Query: 142 LLIRALCELKKADAAFECFKMMQGMNVLPKIETCNDILSLFLKLD 8 I+ LC+LKKA+ +F+CFKMM+ M LPK+ETCND+LSLF++L+ Sbjct: 159 FWIKGLCQLKKAEESFKCFKMMKDMGFLPKVETCNDMLSLFIRLN 203