BLASTX nr result
ID: Gardenia21_contig00030791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030791 (380 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14496.1| unnamed protein product [Coffea canephora] 72 1e-10 >emb|CDP14496.1| unnamed protein product [Coffea canephora] Length = 663 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = -3 Query: 135 VIVHALLVKAQTSNLFTFHRESSRSSQLDDCPQCVDTGEQVQIVS 1 VIVHALLVKAQ SNLFTF RES SQL+DCPQCVDTGEQ +I S Sbjct: 3 VIVHALLVKAQASNLFTFDRESRHFSQLNDCPQCVDTGEQGRIES 47