BLASTX nr result
ID: Gardenia21_contig00030751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030751 (470 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01778.1| unnamed protein product [Coffea canephora] 75 2e-11 >emb|CDP01778.1| unnamed protein product [Coffea canephora] Length = 384 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 358 MAPGTGNGELDNGFRENNASVTENESHKEEELDDQSL 468 MAPGTG+GELDNGFRE NASVTENESHKEEELDDQSL Sbjct: 1 MAPGTGHGELDNGFREKNASVTENESHKEEELDDQSL 37