BLASTX nr result
ID: Gardenia21_contig00030604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030604 (890 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13503.1| unnamed protein product [Coffea canephora] 72 4e-10 >emb|CDP13503.1| unnamed protein product [Coffea canephora] Length = 114 Score = 72.4 bits (176), Expect = 4e-10 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = +1 Query: 1 HPSEGKLQPSLWIFGIFYIILVERVIIHLVDFHALTSVKSGSLSNK 138 HPSEGKLQPSLW+FGIFYI++++R ++ +VDF AL SVKS SL NK Sbjct: 69 HPSEGKLQPSLWVFGIFYILIMQRFVVSMVDFCALASVKSVSLLNK 114