BLASTX nr result
ID: Gardenia21_contig00030565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030565 (233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIG89848.1| hypothetical protein (mitochondrion) [Capsicum an... 50 1e-07 gb|AAA84679.1| unknown protein (chloroplast) [Nicotiana tabacum]... 60 5e-07 >gb|AIG89848.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 132 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +2 Query: 74 LLPWICHLLFRIIARFHSYNYLFVDKITHGKG*FADEELVY 196 LLP C LLF+I++RF S N LF +K T GKG F DEEL Y Sbjct: 92 LLPSTCRLLFQILSRFPSSNSLFFEKRTVGKGRFTDEELAY 132 Score = 32.3 bits (72), Expect(2) = 1e-07 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 3 IYGLVVALALLFANP 47 IYGLVVALALLFANP Sbjct: 65 IYGLVVALALLFANP 79 >gb|AAA84679.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224353|prf||1102209G ORF 7 Length = 51 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 188 IPHPQISPSRGLFCQRISNCRSEILL*FEKANDKSKAI 75 IPHPQISPSR F QRI N R EIL+ FEKANDKSKAI Sbjct: 3 IPHPQISPSRRFFSQRIKNWRREILIEFEKANDKSKAI 40