BLASTX nr result
ID: Gardenia21_contig00030506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030506 (320 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25002.1| hypothetical protein MIMGU_mgv1a018250mg [Erythra... 59 1e-06 >gb|EYU25002.1| hypothetical protein MIMGU_mgv1a018250mg [Erythranthe guttata] Length = 140 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = +3 Query: 135 STFDLITLAAAASNSLVAFCFCNLIIAILLVGSSKPSSNITVRDQQNPTAPP 290 ST +LI++AA SNSL FCFCNLIIAILLVGSSKP SN D+ P + P Sbjct: 4 STIELISMAA--SNSLAVFCFCNLIIAILLVGSSKPISNF---DEFEPKSSP 50