BLASTX nr result
ID: Gardenia21_contig00030451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030451 (218 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98882.1| unnamed protein product [Coffea canephora] 70 6e-10 >emb|CDO98882.1| unnamed protein product [Coffea canephora] Length = 314 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 217 LYAYSHPEVYPEYSTPALSTFEILSDENPNGCYIM 113 LYA ++PEVYPEY TPALSTFEILSDENPNGCYIM Sbjct: 280 LYACTYPEVYPEYPTPALSTFEILSDENPNGCYIM 314