BLASTX nr result
ID: Gardenia21_contig00030276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030276 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04219.1| unnamed protein product [Coffea canephora] 94 5e-17 >emb|CDP04219.1| unnamed protein product [Coffea canephora] Length = 493 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/47 (93%), Positives = 46/47 (97%), Gaps = 1/47 (2%) Frame = -2 Query: 200 FESDD-FVTVDGLGDDESTQILGMQEKMEFWTTEAISFLENDSRGPW 63 FESDD FVTVDGLGDDESTQ+LGMQEKMEFWTTEA+SFLENDSRGPW Sbjct: 447 FESDDGFVTVDGLGDDESTQMLGMQEKMEFWTTEAVSFLENDSRGPW 493