BLASTX nr result
ID: Gardenia21_contig00030252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030252 (395 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP16284.1| unnamed protein product [Coffea canephora] 119 9e-25 emb|CDP16289.1| unnamed protein product [Coffea canephora] 87 4e-15 ref|XP_010088193.1| hypothetical protein L484_005539 [Morus nota... 61 4e-07 ref|XP_012467190.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 ref|XP_007045272.1| Tetratricopeptide repeat (TPR)-like superfam... 59 1e-06 ref|XP_010513901.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_010275860.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >emb|CDP16284.1| unnamed protein product [Coffea canephora] Length = 558 Score = 119 bits (298), Expect = 9e-25 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -2 Query: 199 MTKESLKFFAYSLQRFKASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLVTFISKGYFPH 23 MTKE+LKFFAY LQRFKASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLV FISKGYFPH Sbjct: 1 MTKEALKFFAYGLQRFKASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLVAFISKGYFPH 59 >emb|CDP16289.1| unnamed protein product [Coffea canephora] Length = 65 Score = 87.4 bits (215), Expect = 4e-15 Identities = 46/56 (82%), Positives = 47/56 (83%), Gaps = 2/56 (3%) Frame = -2 Query: 199 MTKESLKFFAY--SLQRFKASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLVTFISK 38 MTKE+LKFFAY SLQRFKASRKFPD HDFN SLHSLTRSN GDLSLKLLV K Sbjct: 1 MTKEALKFFAYTYSLQRFKASRKFPDHHDFNMSLHSLTRSNYGDLSLKLLVILYFK 56 >ref|XP_010088193.1| hypothetical protein L484_005539 [Morus notabilis] gi|587841736|gb|EXB32333.1| hypothetical protein L484_005539 [Morus notabilis] Length = 548 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = -2 Query: 199 MTKESLKFFAYSLQRFKASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLVTFISKGYFPH 23 M +E+L+FFA+ + + +FP FNK LH LT +NCGDLSLK+L F++K Y PH Sbjct: 1 MVRETLQFFAH----LRRTSRFPTPFTFNKLLHHLTSANCGDLSLKILSHFLTKRYVPH 55 >ref|XP_012467190.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 [Gossypium raimondii] gi|823134781|ref|XP_012467191.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 [Gossypium raimondii] gi|763747904|gb|KJB15343.1| hypothetical protein B456_002G171900 [Gossypium raimondii] gi|763747905|gb|KJB15344.1| hypothetical protein B456_002G171900 [Gossypium raimondii] Length = 583 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 3/55 (5%) Frame = -2 Query: 178 FFAYSLQRF---KASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLVTFISKGYFPH 23 +F LQ F K + K+PD + FNK LH LT S+CG LSLKLL F+SKGY PH Sbjct: 35 YFGSPLQFFSDLKKTSKYPDPYSFNKLLHKLTASDCGALSLKLLSFFLSKGYTPH 89 >ref|XP_007045272.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508709207|gb|EOY01104.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 597 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -2 Query: 157 RFKASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLVTFISKGYFPH 23 + K + K+PD FNK LH LT SNCG LSLKLL F+SKGY PH Sbjct: 48 QLKKTSKYPDPFFFNKLLHRLTASNCGTLSLKLLSFFLSKGYTPH 92 >ref|XP_010513901.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 [Camelina sativa] Length = 559 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/59 (49%), Positives = 36/59 (61%) Frame = -2 Query: 199 MTKESLKFFAYSLQRFKASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLVTFISKGYFPH 23 M +E+L+F L R + S FPD NK +H L SNCG LSLKLL +S+GY PH Sbjct: 1 MVREALQF----LSRLRKSSNFPDPFTCNKHIHQLINSNCGVLSLKLLAYLVSRGYTPH 55 >ref|XP_010275860.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 [Nelumbo nucifera] gi|720064141|ref|XP_010275861.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 [Nelumbo nucifera] gi|720064145|ref|XP_010275862.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01740 [Nelumbo nucifera] Length = 546 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/59 (47%), Positives = 38/59 (64%) Frame = -2 Query: 199 MTKESLKFFAYSLQRFKASRKFPDRHDFNKSLHSLTRSNCGDLSLKLLVTFISKGYFPH 23 MT++ L+FF+ + + +FPD NK LH + SNCGDLSLK+L IS+GY PH Sbjct: 1 MTRKVLEFFS----GLRRNARFPDSWTCNKLLHQIITSNCGDLSLKILFDMISRGYTPH 55