BLASTX nr result
ID: Gardenia21_contig00030220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030220 (204 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07634.1| unnamed protein product [Coffea canephora] 103 4e-20 >emb|CDP07634.1| unnamed protein product [Coffea canephora] Length = 1141 Score = 103 bits (258), Expect = 4e-20 Identities = 51/63 (80%), Positives = 53/63 (84%) Frame = -1 Query: 204 SLKVIPPPLIDPRTLVLVDNPVLEGFPGNYPVGFGDLRALIWRCIITNCPKIHGLPAKYY 25 SLK IPP LI TLVLVDNPVLEGFPGNY VGF DL A + RC+ITNCPKIHGLPAKYY Sbjct: 850 SLKAIPP-LIGSGTLVLVDNPVLEGFPGNYSVGFRDLGARLRRCMITNCPKIHGLPAKYY 908 Query: 24 NSC 16 NSC Sbjct: 909 NSC 911