BLASTX nr result
ID: Gardenia21_contig00030179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030179 (496 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13354.1| unnamed protein product [Coffea canephora] 83 9e-14 >emb|CDP13354.1| unnamed protein product [Coffea canephora] Length = 225 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -2 Query: 198 MESRDEVRLLQTAIKQLIEEAGVRNADGPSSDESFAAVCGHNDGSPDDDEEN 43 MESRD+V+LLQTAIKQLIEEA VRN DGPS DESF AV G DGSPDDD+++ Sbjct: 1 MESRDKVKLLQTAIKQLIEEAKVRNTDGPSLDESFVAVSGDKDGSPDDDDDD 52