BLASTX nr result
ID: Gardenia21_contig00030058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030058 (226 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13900.1| unnamed protein product [Coffea canephora] 142 8e-32 ref|XP_011084811.1| PREDICTED: pentatricopeptide repeat-containi... 115 2e-23 ref|XP_009623481.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_010658171.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 emb|CBI25349.3| unnamed protein product [Vitis vinifera] 108 2e-21 ref|XP_006358742.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_004241092.1| PREDICTED: pentatricopeptide repeat-containi... 107 3e-21 ref|XP_009798485.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_010253060.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 ref|XP_010031080.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_010031079.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 gb|KCW50338.1| hypothetical protein EUGRSUZ_J00110 [Eucalyptus g... 105 1e-20 ref|XP_012839886.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 gb|EYU35195.1| hypothetical protein MIMGU_mgv1a024029mg, partial... 105 1e-20 ref|XP_007011261.1| Pentatricopeptide repeat-containing protein,... 101 3e-19 ref|XP_002879887.1| hypothetical protein ARALYDRAFT_903365 [Arab... 98 3e-18 ref|XP_010525519.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 ref|XP_002319343.2| hypothetical protein POPTR_0013s09430g, part... 97 5e-18 ref|XP_011010139.1| PREDICTED: pentatricopeptide repeat-containi... 96 8e-18 ref|XP_002520874.1| pentatricopeptide repeat-containing protein,... 96 1e-17 >emb|CDP13900.1| unnamed protein product [Coffea canephora] Length = 855 Score = 142 bits (359), Expect = 8e-32 Identities = 68/75 (90%), Positives = 72/75 (96%) Frame = -1 Query: 226 ADKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLR 47 AD+SVWLCLLSACQVHRKIELGELAAQ+LFKMDPT GSYY+PLLNLYV+AGLQDKAA LR Sbjct: 733 ADESVWLCLLSACQVHRKIELGELAAQSLFKMDPTNGSYYIPLLNLYVDAGLQDKAANLR 792 Query: 46 SSMRQRGLKKVPGCS 2 SSMRQRGLKK PGCS Sbjct: 793 SSMRQRGLKKTPGCS 807 >ref|XP_011084811.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Sesamum indicum] Length = 775 Score = 115 bits (287), Expect = 2e-23 Identities = 52/74 (70%), Positives = 65/74 (87%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+ +WL LLSAC+VHR +ELGELAA NLFKM+PT+GS Y+ LLNLYVEAGL+++AA LR+ Sbjct: 650 DRGIWLSLLSACRVHRNVELGELAADNLFKMEPTRGSNYIQLLNLYVEAGLKEQAANLRT 709 Query: 43 SMRQRGLKKVPGCS 2 MRQ+GL K+PGCS Sbjct: 710 MMRQKGLTKLPGCS 723 >ref|XP_009623481.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Nicotiana tomentosiformis] Length = 852 Score = 111 bits (277), Expect = 2e-22 Identities = 50/74 (67%), Positives = 63/74 (85%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+ VWLCLLSAC+VH+ +ELGE+AA NL KM+P +GS Y+ LLNLYVEAG +++AA LR+ Sbjct: 733 DRGVWLCLLSACRVHKNVELGEIAANNLLKMEPDRGSNYVQLLNLYVEAGRREEAASLRA 792 Query: 43 SMRQRGLKKVPGCS 2 MRQ+GLKK PGCS Sbjct: 793 LMRQKGLKKSPGCS 806 >ref|XP_010658171.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Vitis vinifera] Length = 855 Score = 108 bits (269), Expect = 2e-21 Identities = 50/75 (66%), Positives = 60/75 (80%) Frame = -1 Query: 226 ADKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLR 47 AD+SVWLCLL AC+ HR +ELGEL A NL KM+P +GS Y+PLLNLY E + D+AA LR Sbjct: 733 ADRSVWLCLLFACRAHRNMELGELVADNLLKMEPARGSNYVPLLNLYGEVEMWDRAANLR 792 Query: 46 SSMRQRGLKKVPGCS 2 +SM+ RGLKK PGCS Sbjct: 793 ASMKGRGLKKSPGCS 807 >emb|CBI25349.3| unnamed protein product [Vitis vinifera] Length = 1241 Score = 108 bits (269), Expect = 2e-21 Identities = 50/75 (66%), Positives = 60/75 (80%) Frame = -1 Query: 226 ADKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLR 47 AD+SVWLCLL AC+ HR +ELGEL A NL KM+P +GS Y+PLLNLY E + D+AA LR Sbjct: 1119 ADRSVWLCLLFACRAHRNMELGELVADNLLKMEPARGSNYVPLLNLYGEVEMWDRAANLR 1178 Query: 46 SSMRQRGLKKVPGCS 2 +SM+ RGLKK PGCS Sbjct: 1179 ASMKGRGLKKSPGCS 1193 >ref|XP_006358742.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720-like [Solanum tuberosum] Length = 850 Score = 108 bits (269), Expect = 2e-21 Identities = 47/74 (63%), Positives = 64/74 (86%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 ++ VWLCLLSAC+VH+ ++LGE+AA+NL KM+P +GS Y+ LLNLYVE G++++AA LR+ Sbjct: 731 ERGVWLCLLSACRVHQNVKLGEIAAKNLLKMEPNRGSNYVQLLNLYVEGGMREEAASLRT 790 Query: 43 SMRQRGLKKVPGCS 2 MRQ+GLKK PGCS Sbjct: 791 LMRQKGLKKNPGCS 804 >ref|XP_004241092.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Solanum lycopersicum] Length = 850 Score = 107 bits (268), Expect = 3e-21 Identities = 47/74 (63%), Positives = 63/74 (85%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 ++ VWLCLLSAC+VH+ ++LGE+AA NL KM+P +GS Y+ LLNLYVE G++++AA LR+ Sbjct: 731 ERGVWLCLLSACRVHQNVKLGEIAANNLLKMEPNRGSNYVQLLNLYVEGGMREEAASLRA 790 Query: 43 SMRQRGLKKVPGCS 2 MRQ+GLKK PGCS Sbjct: 791 LMRQKGLKKNPGCS 804 >ref|XP_009798485.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Nicotiana sylvestris] Length = 852 Score = 107 bits (267), Expect = 4e-21 Identities = 49/74 (66%), Positives = 62/74 (83%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+ VWLCLLSA +VH+ +ELGE+AA NL KM+P +GS Y+ LLNLYVEAG +++AA LR+ Sbjct: 733 DRGVWLCLLSASRVHKNVELGEIAANNLLKMEPNRGSNYVQLLNLYVEAGRREEAASLRA 792 Query: 43 SMRQRGLKKVPGCS 2 MRQ+GLKK PGCS Sbjct: 793 LMRQKGLKKNPGCS 806 >ref|XP_010253060.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Nelumbo nucifera] Length = 870 Score = 106 bits (264), Expect = 8e-21 Identities = 51/74 (68%), Positives = 59/74 (79%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D SVWLCLLSAC+ H IELGE+AA NL KM+P++GS Y LLNLY EA L DKAA LR Sbjct: 750 DMSVWLCLLSACRAHGNIELGEIAASNLLKMEPSRGSNYTQLLNLYREAELWDKAANLRV 809 Query: 43 SMRQRGLKKVPGCS 2 SM+++GLKK PGCS Sbjct: 810 SMKEKGLKKSPGCS 823 >ref|XP_010031080.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 isoform X2 [Eucalyptus grandis] Length = 782 Score = 105 bits (263), Expect = 1e-20 Identities = 46/74 (62%), Positives = 63/74 (85%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+SVWLCLLSAC++H+ +ELGE+AA NL +++P GS Y+ LLNLY EA LQD+A +LR+ Sbjct: 662 DRSVWLCLLSACRIHKNVELGEVAASNLLRIEPDTGSNYVQLLNLYGEAELQDRAVQLRA 721 Query: 43 SMRQRGLKKVPGCS 2 SM+++GL+K PGCS Sbjct: 722 SMKEKGLRKSPGCS 735 >ref|XP_010031079.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 isoform X1 [Eucalyptus grandis] Length = 850 Score = 105 bits (263), Expect = 1e-20 Identities = 46/74 (62%), Positives = 63/74 (85%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+SVWLCLLSAC++H+ +ELGE+AA NL +++P GS Y+ LLNLY EA LQD+A +LR+ Sbjct: 730 DRSVWLCLLSACRIHKNVELGEVAASNLLRIEPDTGSNYVQLLNLYGEAELQDRAVQLRA 789 Query: 43 SMRQRGLKKVPGCS 2 SM+++GL+K PGCS Sbjct: 790 SMKEKGLRKSPGCS 803 >gb|KCW50338.1| hypothetical protein EUGRSUZ_J00110 [Eucalyptus grandis] Length = 755 Score = 105 bits (263), Expect = 1e-20 Identities = 46/74 (62%), Positives = 63/74 (85%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+SVWLCLLSAC++H+ +ELGE+AA NL +++P GS Y+ LLNLY EA LQD+A +LR+ Sbjct: 635 DRSVWLCLLSACRIHKNVELGEVAASNLLRIEPDTGSNYVQLLNLYGEAELQDRAVQLRA 694 Query: 43 SMRQRGLKKVPGCS 2 SM+++GL+K PGCS Sbjct: 695 SMKEKGLRKSPGCS 708 >ref|XP_012839886.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Erythranthe guttatus] Length = 860 Score = 105 bits (262), Expect = 1e-20 Identities = 49/74 (66%), Positives = 60/74 (81%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 DK VW+ LLSAC+VHR IELGE+AA L K++P GS Y+ LLNLYVE G+++KAAKLR Sbjct: 735 DKGVWVSLLSACRVHRNIELGEMAAHKLIKIEPESGSGYIQLLNLYVEMGMKEKAAKLRG 794 Query: 43 SMRQRGLKKVPGCS 2 MR++GL KVPGCS Sbjct: 795 VMREKGLTKVPGCS 808 >gb|EYU35195.1| hypothetical protein MIMGU_mgv1a024029mg, partial [Erythranthe guttata] Length = 820 Score = 105 bits (262), Expect = 1e-20 Identities = 49/74 (66%), Positives = 60/74 (81%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 DK VW+ LLSAC+VHR IELGE+AA L K++P GS Y+ LLNLYVE G+++KAAKLR Sbjct: 703 DKGVWVSLLSACRVHRNIELGEMAAHKLIKIEPESGSGYIQLLNLYVEMGMKEKAAKLRG 762 Query: 43 SMRQRGLKKVPGCS 2 MR++GL KVPGCS Sbjct: 763 VMREKGLTKVPGCS 776 >ref|XP_007011261.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508728174|gb|EOY20071.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 849 Score = 101 bits (251), Expect = 3e-19 Identities = 46/74 (62%), Positives = 62/74 (83%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 ++SVWL LL AC+ + +ELGELAA NL K++P++GS Y+ LL+LY EAGLQDKAA +R+ Sbjct: 728 NRSVWLSLLCACRAYSNVELGELAAHNLLKVEPSRGSNYVQLLHLYGEAGLQDKAANIRA 787 Query: 43 SMRQRGLKKVPGCS 2 +M++RGLKK PGCS Sbjct: 788 TMKERGLKKNPGCS 801 >ref|XP_002879887.1| hypothetical protein ARALYDRAFT_903365 [Arabidopsis lyrata subsp. lyrata] gi|297325726|gb|EFH56146.1| hypothetical protein ARALYDRAFT_903365 [Arabidopsis lyrata subsp. lyrata] Length = 1359 Score = 97.8 bits (242), Expect = 3e-18 Identities = 43/75 (57%), Positives = 60/75 (80%) Frame = -1 Query: 226 ADKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLR 47 AD S+WLCLLSA + H +ELG L+A+ L +M+P +GS Y+ L+NLY+EAGL+++AAKL Sbjct: 1243 ADSSIWLCLLSASRTHHNVELGILSAEKLLRMEPERGSTYVQLINLYMEAGLKNEAAKLL 1302 Query: 46 SSMRQRGLKKVPGCS 2 M++RGL+K PGCS Sbjct: 1303 GEMKERGLQKQPGCS 1317 >ref|XP_010525519.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Tarenaya hassleriana] Length = 896 Score = 97.1 bits (240), Expect = 5e-18 Identities = 41/75 (54%), Positives = 62/75 (82%) Frame = -1 Query: 226 ADKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLR 47 ADKS+WLCLLSA + H +ELG L+A+NL +++P +GS Y+ ++NLY+EAGL++KAA+ Sbjct: 768 ADKSIWLCLLSASRTHHNVELGILSAENLLRIEPDRGSNYVQMINLYMEAGLREKAAETM 827 Query: 46 SSMRQRGLKKVPGCS 2 + M+++GL+K PGCS Sbjct: 828 ALMKEKGLQKKPGCS 842 >ref|XP_002319343.2| hypothetical protein POPTR_0013s09430g, partial [Populus trichocarpa] gi|550325356|gb|EEE95266.2| hypothetical protein POPTR_0013s09430g, partial [Populus trichocarpa] Length = 792 Score = 97.1 bits (240), Expect = 5e-18 Identities = 43/74 (58%), Positives = 59/74 (79%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+S+WL LL +C+VH +ELG+LAA L ++P++GS Y+ LLNLY E LQD+AA LR+ Sbjct: 672 DRSIWLSLLCSCRVHHNVELGKLAAHKLLDIEPSRGSNYVQLLNLYGENELQDRAANLRA 731 Query: 43 SMRQRGLKKVPGCS 2 SM+++GLKK PGCS Sbjct: 732 SMKEKGLKKTPGCS 745 >ref|XP_011010139.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Populus euphratica] Length = 850 Score = 96.3 bits (238), Expect = 8e-18 Identities = 43/74 (58%), Positives = 59/74 (79%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+S+WL LL +C+VH +ELG+LAA L ++P++GS Y+ LLNLY E LQD+AA LR+ Sbjct: 727 DRSIWLSLLCSCRVHHNVELGKLAAHKLLDIEPSRGSNYVQLLNLYGENELQDRAANLRA 786 Query: 43 SMRQRGLKKVPGCS 2 SM+++GLKK PGCS Sbjct: 787 SMKEKGLKKSPGCS 800 >ref|XP_002520874.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540005|gb|EEF41583.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 833 Score = 95.9 bits (237), Expect = 1e-17 Identities = 42/74 (56%), Positives = 57/74 (77%) Frame = -1 Query: 223 DKSVWLCLLSACQVHRKIELGELAAQNLFKMDPTKGSYYMPLLNLYVEAGLQDKAAKLRS 44 D+S+WL LL +C++H +ELGE+ A L M+P+KGS Y+ LLNLY EA L D+ A LR+ Sbjct: 712 DRSIWLSLLCSCKIHLNLELGEMVANKLLNMEPSKGSNYVQLLNLYGEAELWDRTANLRA 771 Query: 43 SMRQRGLKKVPGCS 2 SM+++GLKK PGCS Sbjct: 772 SMKEKGLKKTPGCS 785