BLASTX nr result
ID: Gardenia21_contig00030057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030057 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98383.1| unnamed protein product [Coffea canephora] 59 2e-06 ref|XP_011072927.1| PREDICTED: pre-mRNA-splicing factor SPF27 ho... 56 9e-06 >emb|CDO98383.1| unnamed protein product [Coffea canephora] Length = 196 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 ILRLENLELMSKHGPEVWKIYNQKLEALVS 3 ++RLENLE MSKHGPEVWKIYN+KLEALVS Sbjct: 81 VIRLENLEQMSKHGPEVWKIYNKKLEALVS 110 >ref|XP_011072927.1| PREDICTED: pre-mRNA-splicing factor SPF27 homolog [Sesamum indicum] Length = 253 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 92 ILRLENLELMSKHGPEVWKIYNQKLEALVS 3 ++RLENL+LMSKHGPEVWK+YNQ+LEA +S Sbjct: 137 VIRLENLDLMSKHGPEVWKLYNQQLEAFLS 166