BLASTX nr result
ID: Gardenia21_contig00030047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00030047 (205 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP22045.1| unnamed protein product [Coffea canephora] 66 9e-09 >emb|CDP22045.1| unnamed protein product [Coffea canephora] Length = 78 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = +3 Query: 9 INNSIKFS*MDPNNDDDETDIVIGAATSVLVAGYVALEAYKTPIVILKPPYINRK 173 + +S+++S NDDDE IVIGAATSVL A Y ALE YKTP+VI KPP++NR+ Sbjct: 27 LTHSLRYS---IGNDDDEDAIVIGAATSVLAARYAALEVYKTPVVIPKPPHVNRE 78