BLASTX nr result
ID: Gardenia21_contig00029963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00029963 (217 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98337.1| unnamed protein product [Coffea canephora] 73 9e-11 emb|CEM22591.1| unnamed protein product [Vitrella brassicaformis... 67 5e-09 ref|XP_005839379.1| large subunit ribosomal protein L19e, cytopl... 65 2e-08 gb|KOM39493.1| hypothetical protein LR48_Vigan03g287500 [Vigna a... 65 2e-08 ref|XP_009391009.1| PREDICTED: 60S ribosomal protein L19-1 [Musa... 65 2e-08 ref|XP_012083992.1| PREDICTED: 60S ribosomal protein L19-3 [Jatr... 65 3e-08 ref|XP_012082823.1| PREDICTED: 60S ribosomal protein L19-1 [Jatr... 65 3e-08 gb|KDP27846.1| hypothetical protein JCGZ_18926 [Jatropha curcas] 65 3e-08 ref|XP_002523128.1| 60S ribosomal protein L19, putative [Ricinus... 65 3e-08 ref|XP_006838023.1| PREDICTED: 60S ribosomal protein L19-3 [Ambo... 65 3e-08 ref|XP_004831927.1| 60S ribosomal protein L19, putative [Babesia... 65 3e-08 ref|XP_004361087.1| S60 ribosomal protein L19 [Dictyostelium fas... 65 3e-08 ref|NP_001241295.1| uncharacterized protein LOC100818880 [Glycin... 65 3e-08 ref|NP_001050051.1| Os03g0337800 [Oryza sativa Japonica Group] g... 65 3e-08 emb|CDY18029.1| BnaC03g31010D [Brassica napus] 64 3e-08 dbj|BAN65145.1| 60S ribosomal protein L19, putative [Babesia bovis] 64 3e-08 ref|XP_006574542.1| PREDICTED: 60S ribosomal protein L19-1-like ... 64 3e-08 emb|CBN76992.1| conserved unknown protein [Ectocarpus siliculosus] 64 3e-08 ref|XP_001608966.1| 60S ribosomal protein L19 [Babesia bovis T2B... 64 3e-08 ref|NP_171777.1| 60S ribosomal protein L19-1 [Arabidopsis thalia... 64 4e-08 >emb|CDO98337.1| unnamed protein product [Coffea canephora] Length = 175 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANSSMS 203 SLRLQKRLAASILKCG+G+VWLDPNETNDISTANS M+ Sbjct: 3 SLRLQKRLAASILKCGRGKVWLDPNETNDISTANSRMA 40 >emb|CEM22591.1| unnamed protein product [Vitrella brassicaformis CCMP3155] Length = 191 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SLRLQKRLAAS+LKCGKG +WLDPNETN+IS ANS Sbjct: 2 SLRLQKRLAASVLKCGKGRIWLDPNETNEISMANS 36 >ref|XP_005839379.1| large subunit ribosomal protein L19e, cytoplasmic [Guillardia theta CCMP2712] gi|428183541|gb|EKX52399.1| large subunit ribosomal protein L19e, cytoplasmic [Guillardia theta CCMP2712] Length = 210 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SLRLQKRLAAS+LKCGKG++WLDPNE N+IS ANS Sbjct: 3 SLRLQKRLAASVLKCGKGKIWLDPNEVNEISMANS 37 >gb|KOM39493.1| hypothetical protein LR48_Vigan03g287500 [Vigna angularis] Length = 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCG+G+VWLDPNE NDIS ANS Sbjct: 3 SLKLQKRLAASVLKCGRGKVWLDPNEVNDISMANS 37 >ref|XP_009391009.1| PREDICTED: 60S ribosomal protein L19-1 [Musa acuminata subsp. malaccensis] Length = 205 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCG+G+VWLDPNE NDIS ANS Sbjct: 3 SLKLQKRLAASVLKCGRGKVWLDPNEVNDISMANS 37 >ref|XP_012083992.1| PREDICTED: 60S ribosomal protein L19-3 [Jatropha curcas] Length = 206 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG+VWLDPNE N+IS ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANS 37 >ref|XP_012082823.1| PREDICTED: 60S ribosomal protein L19-1 [Jatropha curcas] gi|643716575|gb|KDP28201.1| hypothetical protein JCGZ_13972 [Jatropha curcas] Length = 210 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG+VWLDPNE N+IS ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANS 37 >gb|KDP27846.1| hypothetical protein JCGZ_18926 [Jatropha curcas] Length = 206 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG+VWLDPNE N+IS ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANS 37 >ref|XP_002523128.1| 60S ribosomal protein L19, putative [Ricinus communis] gi|223537690|gb|EEF39313.1| 60S ribosomal protein L19, putative [Ricinus communis] Length = 208 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG+VWLDPNE N+IS ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKVWLDPNEANEISMANS 37 >ref|XP_006838023.1| PREDICTED: 60S ribosomal protein L19-3 [Amborella trichopoda] gi|548840441|gb|ERN00592.1| hypothetical protein AMTR_s00091p00066640 [Amborella trichopoda] Length = 207 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG+VWLDPNET++IS ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKVWLDPNETSEISMANS 37 >ref|XP_004831927.1| 60S ribosomal protein L19, putative [Babesia equi] gi|428671557|gb|EKX72475.1| 60S ribosomal protein L19, putative [Babesia equi strain WA] Length = 179 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 93 LRLQKRLAASILKCGKGEVWLDPNETNDISTANSSMS 203 LRLQKRLAAS+L+CGKG VWLDPNETN+I+ ANS S Sbjct: 3 LRLQKRLAASVLRCGKGRVWLDPNETNEIAMANSRFS 39 >ref|XP_004361087.1| S60 ribosomal protein L19 [Dictyostelium fasciculatum] gi|328874871|gb|EGG23236.1| S60 ribosomal protein L19 [Dictyostelium fasciculatum] Length = 183 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SLRLQKRLAASILKCGKG VW+DPNE +++STANS Sbjct: 3 SLRLQKRLAASILKCGKGRVWIDPNEISEVSTANS 37 >ref|NP_001241295.1| uncharacterized protein LOC100818880 [Glycine max] gi|255647307|gb|ACU24120.1| unknown [Glycine max] gi|734338052|gb|KHN08667.1| 60S ribosomal protein L19-2 [Glycine soja] gi|947121063|gb|KRH69269.1| hypothetical protein GLYMA_02G016000 [Glycine max] Length = 212 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG+VWLDPNE N+IS ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANS 37 >ref|NP_001050051.1| Os03g0337800 [Oryza sativa Japonica Group] gi|108708037|gb|ABF95832.1| 60S ribosomal protein L19-1, putative, expressed [Oryza sativa Japonica Group] gi|113548522|dbj|BAF11965.1| Os03g0337800 [Oryza sativa Japonica Group] gi|125543790|gb|EAY89929.1| hypothetical protein OsI_11477 [Oryza sativa Indica Group] gi|125586185|gb|EAZ26849.1| hypothetical protein OsJ_10765 [Oryza sativa Japonica Group] gi|215734967|dbj|BAG95689.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765261|dbj|BAG86958.1| unnamed protein product [Oryza sativa Japonica Group] gi|937909178|dbj|BAS84098.1| Os03g0337800 [Oryza sativa Japonica Group] Length = 208 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG+VWLDPNE N+IS ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANS 37 >emb|CDY18029.1| BnaC03g31010D [Brassica napus] Length = 176 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG+VWLDPNE NDI+ ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKVWLDPNEGNDIAMANS 37 >dbj|BAN65145.1| 60S ribosomal protein L19, putative [Babesia bovis] Length = 97 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANSSMS 203 +LRLQKRLAAS+LKCGKG +WLDPNE+N+I+ ANS S Sbjct: 2 NLRLQKRLAASVLKCGKGRIWLDPNESNEIAMANSRFS 39 >ref|XP_006574542.1| PREDICTED: 60S ribosomal protein L19-1-like [Glycine max] gi|734338051|gb|KHN08666.1| 60S ribosomal protein L19-2 [Glycine soja] gi|947121062|gb|KRH69268.1| hypothetical protein GLYMA_02G015900 [Glycine max] Length = 212 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANSSMS 203 SL+LQKRLAAS+LKCG+G+VWLDPNE N+IS ANS ++ Sbjct: 3 SLKLQKRLAASVLKCGRGKVWLDPNEVNEISMANSRLN 40 >emb|CBN76992.1| conserved unknown protein [Ectocarpus siliculosus] Length = 190 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS+LKCGKG++WLDPNE N+IS ANS Sbjct: 3 SLKLQKRLAASVLKCGKGKIWLDPNEVNEISLANS 37 >ref|XP_001608966.1| 60S ribosomal protein L19 [Babesia bovis T2Bo] gi|154796216|gb|EDO05398.1| 60S ribosomal protein L19, putative [Babesia bovis] Length = 181 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANSSMS 203 +LRLQKRLAAS+LKCGKG +WLDPNE+N+I+ ANS S Sbjct: 2 NLRLQKRLAASVLKCGKGRIWLDPNESNEIAMANSRFS 39 >ref|NP_171777.1| 60S ribosomal protein L19-1 [Arabidopsis thaliana] gi|20143885|sp|Q9SRX2.1|RL191_ARATH RecName: Full=60S ribosomal protein L19-1; AltName: Full=Protein EMBRYO DEFECTIVE 2386 gi|6056425|gb|AAF02889.1|AC009525_23 Putative ribosomal protein L19 [Arabidopsis thaliana] gi|15983412|gb|AAL11574.1|AF424580_1 At1g02780/T14P4_3 [Arabidopsis thaliana] gi|33589762|gb|AAQ22647.1| At1g02780/T14P4_3 [Arabidopsis thaliana] gi|332189348|gb|AEE27469.1| 60S ribosomal protein L19-1 [Arabidopsis thaliana] Length = 214 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 90 SLRLQKRLAASILKCGKGEVWLDPNETNDISTANS 194 SL+LQKRLAAS++KCGKG+VWLDPNE++DIS ANS Sbjct: 3 SLKLQKRLAASVMKCGKGKVWLDPNESSDISMANS 37