BLASTX nr result
ID: Gardenia21_contig00029914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00029914 (668 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02896.1| unnamed protein product [Coffea canephora] 119 2e-26 >emb|CDP02896.1| unnamed protein product [Coffea canephora] Length = 207 Score = 119 bits (297), Expect(2) = 2e-26 Identities = 59/77 (76%), Positives = 67/77 (87%) Frame = -1 Query: 356 TISCFEMALTGRKEKSMKSVAKEPRDIGEKTKSTSIADQHVDGYPYPRGTIIKRTVLQQE 177 T+SC EMALTGRK +S+K+VA+E RDIG+K K SIADQHVDGY YPR TIIK TVLQQE Sbjct: 117 TMSCSEMALTGRKGESVKNVAEETRDIGQKIKRISIADQHVDGYSYPRSTIIKHTVLQQE 176 Query: 176 TVKHVIKQSCPSSSVQG 126 T+KHVIKQSC S+SVQG Sbjct: 177 TLKHVIKQSCWSASVQG 193 Score = 28.1 bits (61), Expect(2) = 2e-26 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -2 Query: 67 ATVKRKELLGPNVRKLV*Q 11 A+V+ K LLGPNVRKLV Q Sbjct: 189 ASVQGKGLLGPNVRKLVQQ 207