BLASTX nr result
ID: Gardenia21_contig00029789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00029789 (328 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17436.1| unnamed protein product [Coffea canephora] 74 5e-11 >emb|CDP17436.1| unnamed protein product [Coffea canephora] Length = 536 Score = 73.6 bits (179), Expect = 5e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 236 MGRSRAVPHSADEDLSQSRSKRKRTASNVENSEIATA 126 MGRSRAVPHSADEDLSQSRSKRKRTASNVENSEIATA Sbjct: 1 MGRSRAVPHSADEDLSQSRSKRKRTASNVENSEIATA 37