BLASTX nr result
ID: Gardenia21_contig00029704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00029704 (300 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04586.1| unnamed protein product [Coffea canephora] 126 7e-27 >emb|CDP04586.1| unnamed protein product [Coffea canephora] Length = 517 Score = 126 bits (316), Expect = 7e-27 Identities = 61/75 (81%), Positives = 65/75 (86%) Frame = -1 Query: 225 MKHLLASIRRRHCRHAATLLQRSYYQSLKPQPPSEPPTSHTKSSWSTHESAMPIRDVNDL 46 MKHLLA+IRR HCRHAA LQ +YYQSLKPQ PSEP TS TKSSWS HE+AMPI+DVN L Sbjct: 1 MKHLLATIRRSHCRHAAPFLQLAYYQSLKPQSPSEPATSLTKSSWSIHENAMPIQDVNGL 60 Query: 45 QIAKQADRICQILSN 1 QIAKQ DRICQILSN Sbjct: 61 QIAKQTDRICQILSN 75