BLASTX nr result
ID: Gardenia21_contig00029310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00029310 (262 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013442820.1| ribosomal protein S12C [Medicago truncatula]... 94 1e-17 ref|YP_008992372.1| ribosomal protein S12 (mitochondrion) [Salvi... 90 6e-16 ref|YP_006460182.1| ribosomal protein subunit S12 (mitochondrion... 90 6e-16 ref|YP_173380.1| ribosomal protein S12 [Nicotiana tabacum] gi|67... 89 1e-15 ref|YP_009041158.1| ribosomal protein S12 (mitochondrion) [Rhazy... 89 1e-15 gb|AHX81341.1| ribosomal protein S12 (mitochondrion) [Chrysobala... 89 1e-15 gb|AAD03039.1| ribosomal protein S12 [Solanum tuberosum] 89 1e-15 ref|YP_005090426.1| rps12 gene product (mitochondrion) [Boea hyg... 89 2e-15 gb|AGL75403.1| ribosomal protein S12 (mitochondrion) [Utriculari... 88 3e-15 sp|P68535.1|RT12_PETHY RecName: Full=Ribosomal protein S12, mito... 87 4e-15 ref|YP_009121959.1| ribosomal protein S12 (mitochondrion) [Hyosc... 87 4e-15 sp|Q95869.1|RT12_NICSY RecName: Full=Ribosomal protein S12, mito... 87 6e-15 ref|YP_006666121.1| ribosomal protein S12 (mitochondrion) [Malus... 87 6e-15 gb|EPS74625.1| hypothetical protein M569_00104 [Genlisea aurea] 86 1e-14 ref|YP_009045786.1| ribosomal protein S12 (mitochondrion) [Batis... 86 1e-14 ref|YP_009173845.1| ribosomal protein S12 (mitochondrion) [Popul... 85 2e-14 sp|Q96033.1|RT12_HELAN RecName: Full=Ribosomal protein S12, mito... 85 2e-14 ref|YP_003587241.1| ribosomal protein S12 [Citrullus lanatus] gi... 85 2e-14 ref|YP_008802516.1| ribosomal protein S12 (mitochondrion) (mitoc... 85 2e-14 ref|YP_005090462.1| ribosomal protein S12 (mitochondrion) [Mille... 85 2e-14 >ref|XP_013442820.1| ribosomal protein S12C [Medicago truncatula] gi|657370784|gb|KEH16845.1| ribosomal protein S12C [Medicago truncatula] Length = 362 Score = 93.6 bits (231), Expect(2) = 1e-17 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = -2 Query: 156 RIGGRTKERAMPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 R GGRTKERAMPTLNQLIRHGREEK+RTDRTRA DQCPQK+GV PRV RTP Sbjct: 228 RGGGRTKERAMPTLNQLIRHGREEKRRTDRTRASDQCPQKQGVRPRVFKRTP 279 Score = 22.7 bits (47), Expect(2) = 1e-17 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 218 GFLYEWKRG 192 G LYEWKRG Sbjct: 221 GSLYEWKRG 229 >ref|YP_008992372.1| ribosomal protein S12 (mitochondrion) [Salvia miltiorrhiza] gi|534292342|gb|AGU16634.1| ribosomal protein S12 (mitochondrion) [Salvia miltiorrhiza] Length = 125 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQKEGVCPRVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKEGVCPRVSTRTP 42 >ref|YP_006460182.1| ribosomal protein subunit S12 (mitochondrion) (mitochondrion) [Erythranthe guttata] gi|340007667|gb|AEK26531.1| ribosomal protein subunit S12 (mitochondrion) (mitochondrion) [Erythranthe guttata] Length = 125 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQKEGVCPRVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKEGVCPRVSTRTP 42 >ref|YP_173380.1| ribosomal protein S12 [Nicotiana tabacum] gi|675895272|ref|YP_009049746.1| ribosomal protein S12 (mitochondrion) [Capsicum annuum] gi|697143893|ref|XP_009626068.1| PREDICTED: ribosomal protein S12, mitochondrial [Nicotiana tomentosiformis] gi|667751851|gb|AIG89938.1| ribosomal protein S12 (mitochondrion) [Capsicum annuum] gi|667752018|gb|AIG90104.1| ribosomal protein S12 (mitochondrion) [Capsicum annuum] gi|756762095|gb|AJM70204.1| ribosomal protein S12 (mitochondrion) [Nicotiana tabacum/Hyoscyamus niger cybrid] gi|927029472|gb|ALD61766.1| ribosomal protein S12 (mitochondrion) [Nicotiana tabacum] Length = 125 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVCPRVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTP 42 >ref|YP_009041158.1| ribosomal protein S12 (mitochondrion) [Rhazya stricta] gi|645929281|gb|AIB08804.1| ribosomal protein S12 (mitochondrion) [Rhazya stricta] Length = 125 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVCPRVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTP 42 >gb|AHX81341.1| ribosomal protein S12 (mitochondrion) [Chrysobalanus icaco] gi|618627118|gb|AHX81346.1| ribosomal protein S12 (mitochondrion) [Licania alba] gi|618627126|gb|AHX81352.1| ribosomal protein S12 (mitochondrion) [Licania heteromorpha] gi|618627132|gb|AHX81357.1| ribosomal protein S12 (mitochondrion) [Licania sprucei] gi|618627348|gb|AHX81473.1| ribosomal protein S12 (mitochondrion) [Parinari campestris] gi|618627432|gb|AHX81516.1| ribosomal protein S12 (mitochondrion) [Hirtella physophora] gi|618627460|gb|AHX81530.1| ribosomal protein S12 (mitochondrion) [Couepia guianensis] gi|618627501|gb|AHX81550.1| ribosomal protein S12 (mitochondrion) [Hirtella racemosa] Length = 125 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVCPRVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTP 42 >gb|AAD03039.1| ribosomal protein S12 [Solanum tuberosum] Length = 123 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVCPRVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTP 42 >ref|YP_005090426.1| rps12 gene product (mitochondrion) [Boea hygrometrica] gi|340549499|gb|AEK53320.1| ribosomal protein S12 (mitochondrion) [Boea hygrometrica] Length = 125 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPT NQLIRHGREEK+RTDRTRALDQCPQKEGVCPRVSTRTP Sbjct: 1 MPTFNQLIRHGREEKRRTDRTRALDQCPQKEGVCPRVSTRTP 42 >gb|AGL75403.1| ribosomal protein S12 (mitochondrion) [Utricularia gibba] Length = 125 Score = 87.8 bits (216), Expect = 3e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPT NQLIRHGREEK+RTDRTRALDQCPQKEGVCPRVSTRTP Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRALDQCPQKEGVCPRVSTRTP 42 >sp|P68535.1|RT12_PETHY RecName: Full=Ribosomal protein S12, mitochondrial gi|55977315|sp|P68536.1|RT12_PETPA RecName: Full=Ribosomal protein S12, mitochondrial gi|7440357|pir||JC6098 ribosomal protein S12 - petunia mitochondrion gi|1046293|gb|AAA80309.1| ribosomal protein S12 [Petunia axillaris subsp. parodii] gi|1046303|gb|AAB82732.1| ribosomal protein S12 [Petunia x hybrida] gi|1256948|gb|AAA96604.1| ribosomal protein S12 [Petunia axillaris subsp. parodii] gi|1589661|prf||2211395A ribosomal protein S12 Length = 125 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MP+LNQLIRHGREEK+RTDRTRALDQCPQK+GVCPRVSTRTP Sbjct: 1 MPSLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTP 42 >ref|YP_009121959.1| ribosomal protein S12 (mitochondrion) [Hyoscyamus niger] gi|756142186|gb|AJK91397.1| ribosomal protein S12 (mitochondrion) [Hyoscyamus niger] Length = 125 Score = 87.4 bits (215), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPT NQLIRHGREEK+RTDRTRALDQCPQK+GVCPRVSTRTP Sbjct: 1 MPTFNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTP 42 >sp|Q95869.1|RT12_NICSY RecName: Full=Ribosomal protein S12, mitochondrial gi|1563736|emb|CAA65515.1| ribosomal protein S12 [Nicotiana sylvestris] Length = 125 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPT NQLIRHGREEK+RTDRTRALDQCPQK+GVCPRVSTRTP Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRALDQCPQKQGVCPRVSTRTP 42 >ref|YP_006666121.1| ribosomal protein S12 (mitochondrion) [Malus domestica] gi|404481701|ref|YP_006666133.1| ribosomal protein S12 (mitochondrion) [Malus domestica] gi|384080912|dbj|BAM11118.1| ribosomal protein S12 (mitochondrion) [Malus domestica] gi|384080914|dbj|BAM11119.1| ribosomal protein S12 (mitochondrion) [Malus domestica] gi|401661925|emb|CBX33380.1| rps12 (mitochondrion) [Malus domestica] gi|401661936|emb|CBX33395.1| rps12 (mitochondrion) [Malus domestica] gi|939462386|gb|ALJ78541.1| ribosomal protein S12 (mitochondrion) [Malus hupehensis var. mengshanensis] Length = 125 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRA DQCPQK+GVCPRVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRASDQCPQKQGVCPRVSTRTP 42 >gb|EPS74625.1| hypothetical protein M569_00104 [Genlisea aurea] Length = 125 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPT NQLIRHGREEK+RTDRTRALDQCPQKEGVCPRVSTR P Sbjct: 1 MPTKNQLIRHGREEKRRTDRTRALDQCPQKEGVCPRVSTRAP 42 >ref|YP_009045786.1| ribosomal protein S12 (mitochondrion) [Batis maritima] gi|655168560|gb|AIC83389.1| ribosomal protein S12 (mitochondrion) (mitochondrion) [Batis maritima] Length = 125 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPT+NQLIRHGREEK+RTDRTRA DQCPQK+GVCPRVSTRTP Sbjct: 1 MPTVNQLIRHGREEKRRTDRTRASDQCPQKQGVCPRVSTRTP 42 >ref|YP_009173845.1| ribosomal protein S12 (mitochondrion) [Populus tremula] gi|948299285|ref|YP_009178742.1| ribosomal protein S12 (mitochondrion) [Populus tremula x Populus alba] gi|936227483|gb|ALH07317.1| ribosomal protein S12 (mitochondrion) [Populus tremula] gi|938485554|gb|ALJ49773.1| ribosomal protein S12 (mitochondrion) [Populus tremula x Populus alba] Length = 125 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVC RVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTP 42 >sp|Q96033.1|RT12_HELAN RecName: Full=Ribosomal protein S12, mitochondrial gi|1518351|emb|CAA89857.1| ribosomal protein S12 [Helianthus annuus] Length = 125 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVC RVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTP 42 >ref|YP_003587241.1| ribosomal protein S12 [Citrullus lanatus] gi|259156786|gb|ACV96648.1| ribosomal protein S12 [Citrullus lanatus] Length = 123 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVC RVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTP 42 >ref|YP_008802516.1| ribosomal protein S12 (mitochondrion) (mitochondrion) [Asclepias syriaca] gi|556562354|gb|AGZ63050.1| ribosomal protein S12 (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 125 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVC RVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTP 42 >ref|YP_005090462.1| ribosomal protein S12 (mitochondrion) [Millettia pinnata] gi|372450318|ref|YP_005090500.1| ribosomal protein S12 (mitochondrion) [Lotus japonicus] gi|576303576|ref|YP_008999593.1| ribosomal protein S12 (mitochondrion) [Vaccinium macrocarpon] gi|316996005|dbj|BAD83444.2| ribosomal protein S12 (mitochondrion) [Nicotiana tabacum] gi|357197325|gb|AET62922.1| ribosomal protein S12 (mitochondrion) [Millettia pinnata] gi|357197364|gb|AET62960.1| ribosomal protein S12 (mitochondrion) [Lotus japonicus] gi|549531668|gb|AGX28807.1| ribosomal protein S12 (mitochondrion) [Vaccinium macrocarpon] Length = 125 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 126 MPTLNQLIRHGREEKQRTDRTRALDQCPQKEGVCPRVSTRTP 1 MPTLNQLIRHGREEK+RTDRTRALDQCPQK+GVC RVSTRTP Sbjct: 1 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCLRVSTRTP 42