BLASTX nr result
ID: Gardenia21_contig00029269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00029269 (238 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010108948.1| hypothetical protein L484_027143 [Morus nota... 76 1e-11 ref|XP_010647985.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 emb|CBI25078.3| unnamed protein product [Vitis vinifera] 76 1e-11 ref|XP_012480229.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_002300569.2| hypothetical protein POPTR_0001s47030g, part... 74 4e-11 ref|XP_007042438.1| Tetratricopeptide repeat (TPR)-like superfam... 74 4e-11 ref|XP_008236588.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 ref|XP_007198996.1| hypothetical protein PRUPE_ppa002176mg [Prun... 74 6e-11 ref|XP_009764429.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_009764410.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_009591801.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_003624942.2| pentatricopeptide (PPR) repeat protein [Medi... 72 1e-10 gb|ABN08546.1| Tetratricopeptide-like helical [Medicago truncatula] 72 1e-10 ref|XP_009346255.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_002518758.1| pentatricopeptide repeat-containing protein,... 71 3e-10 gb|KRG98629.1| hypothetical protein GLYMA_18G085900 [Glycine max] 71 4e-10 ref|XP_011039801.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_008373135.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_004493379.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 >ref|XP_010108948.1| hypothetical protein L484_027143 [Morus notabilis] gi|587933625|gb|EXC20588.1| hypothetical protein L484_027143 [Morus notabilis] Length = 778 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFFR 3 ALINMYAKFG L N +VFDQMV+RD+VSWNS+I+AYEQND P A+ F++ Sbjct: 242 ALINMYAKFGWLANARRVFDQMVVRDLVSWNSIISAYEQNDDPISALRFYK 292 >ref|XP_010647985.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Length = 819 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYAKFG LG+ KVF QM LRD+VSWNS+IAAYEQND P A FF Sbjct: 284 ALINMYAKFGNLGDAQKVFQQMFLRDVVSWNSIIAAYEQNDDPVTARGFF 333 >emb|CBI25078.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYAKFG LG+ KVF QM LRD+VSWNS+IAAYEQND P A FF Sbjct: 190 ALINMYAKFGNLGDAQKVFQQMFLRDVVSWNSIIAAYEQNDDPVTARGFF 239 >ref|XP_012480229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Gossypium raimondii] gi|763765115|gb|KJB32369.1| hypothetical protein B456_005G237500 [Gossypium raimondii] Length = 816 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYAKFGEL N KV D MV+RD+VSWNS+IAAYEQND P A+ F Sbjct: 282 ALINMYAKFGELANAQKVLDNMVVRDVVSWNSIIAAYEQNDDPNRALALF 331 >ref|XP_002300569.2| hypothetical protein POPTR_0001s47030g, partial [Populus trichocarpa] gi|550350056|gb|EEE85374.2| hypothetical protein POPTR_0001s47030g, partial [Populus trichocarpa] Length = 751 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYAKFG LG+ KVF QMV+RDIVSWNS+IAAYEQN+ P A FF Sbjct: 239 ALINMYAKFGSLGHAQKVFGQMVVRDIVSWNSIIAAYEQNNNPVSAHLFF 288 >ref|XP_007042438.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508706373|gb|EOX98269.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 820 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYAKFG+L + KVFD MV+RD+VSWNS+IAAYEQND P A+ F Sbjct: 284 ALINMYAKFGKLEHAQKVFDHMVVRDLVSWNSIIAAYEQNDDPHMALGLF 333 >ref|XP_008236588.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Prunus mume] Length = 820 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -3 Query: 161 IC-ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 IC ALINMY+KFG LG+ ++FDQM +RD+VSWNS+IAAYEQND P A+ F Sbjct: 281 ICNALINMYSKFGSLGHARRIFDQMDIRDLVSWNSIIAAYEQNDDPMTALGLF 333 >ref|XP_007198996.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica] gi|462394396|gb|EMJ00195.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica] Length = 705 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -3 Query: 161 IC-ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 IC ALINMY+KFG LG+ ++FDQM +RD+VSWNS+IAAYEQND P A+ F Sbjct: 166 ICNALINMYSKFGSLGHARRIFDQMDIRDLVSWNSIIAAYEQNDDPMTALGLF 218 >ref|XP_009764429.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X3 [Nicotiana sylvestris] Length = 834 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYA+FGEL + KVFD M++RD++SWNS+IAAYEQN++P A+ +F Sbjct: 298 ALINMYARFGELRHAQKVFDDMIVRDLISWNSLIAAYEQNNVPEKALKYF 347 >ref|XP_009764410.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536141|ref|XP_009764411.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536144|ref|XP_009764413.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536147|ref|XP_009764414.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536150|ref|XP_009764415.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536153|ref|XP_009764416.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536157|ref|XP_009764417.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536160|ref|XP_009764418.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536163|ref|XP_009764419.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536166|ref|XP_009764420.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536170|ref|XP_009764421.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536173|ref|XP_009764422.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536176|ref|XP_009764423.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536179|ref|XP_009764424.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536182|ref|XP_009764425.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536185|ref|XP_009764426.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X2 [Nicotiana sylvestris] gi|698536188|ref|XP_009764427.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] Length = 852 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYA+FGEL + KVFD M++RD++SWNS+IAAYEQN++P A+ +F Sbjct: 316 ALINMYARFGELRHAQKVFDDMIVRDLISWNSLIAAYEQNNVPEKALKYF 365 >ref|XP_009591801.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like, partial [Nicotiana tomentosiformis] Length = 842 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYA+FGEL + KVFD M++RD++SWNS+IAAYEQN++P A+ +F Sbjct: 306 ALINMYARFGELRHAQKVFDDMIVRDLISWNSLIAAYEQNNVPEKALKYF 355 >ref|XP_003624942.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657379118|gb|AES81160.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 1099 Score = 72.4 bits (176), Expect = 1e-10 Identities = 40/78 (51%), Positives = 50/78 (64%) Frame = -3 Query: 236 SDGII*GH*FRFEPSKFEVDS*ED*ICALINMYAKFGELGNT*KVFDQMVLRDIVSWNSV 57 SD +I G K +DS ALINMY+KFG L + VFDQM +RD+VSWNS+ Sbjct: 235 SDDVINGVLIHLHVLKHGLDSDVFVSNALINMYSKFGRLQDAQMVFDQMEVRDLVSWNSI 294 Query: 56 IAAYEQNDLPGCAINFFR 3 IAAYEQN+ P A+ FF+ Sbjct: 295 IAAYEQNNDPSTALRFFK 312 >gb|ABN08546.1| Tetratricopeptide-like helical [Medicago truncatula] Length = 1083 Score = 72.4 bits (176), Expect = 1e-10 Identities = 40/78 (51%), Positives = 50/78 (64%) Frame = -3 Query: 236 SDGII*GH*FRFEPSKFEVDS*ED*ICALINMYAKFGELGNT*KVFDQMVLRDIVSWNSV 57 SD +I G K +DS ALINMY+KFG L + VFDQM +RD+VSWNS+ Sbjct: 235 SDDVINGVLIHLHVLKHGLDSDVFVSNALINMYSKFGRLQDAQMVFDQMEVRDLVSWNSI 294 Query: 56 IAAYEQNDLPGCAINFFR 3 IAAYEQN+ P A+ FF+ Sbjct: 295 IAAYEQNNDPSTALRFFK 312 >ref|XP_009346255.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Pyrus x bretschneideri] Length = 820 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMY+KFG LG+ +VFDQM +RD+VSWNS+IAAYEQN+ P A+ F Sbjct: 284 ALINMYSKFGSLGHARRVFDQMEVRDLVSWNSIIAAYEQNNDPITALELF 333 >ref|XP_002518758.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542139|gb|EEF43683.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 379 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALI MYAKFG LG KVFD MV+RDIVSWNS+IAAYEQND A +FF Sbjct: 98 ALIAMYAKFGSLGLAQKVFDHMVVRDIVSWNSIIAAYEQNDDAATARSFF 147 >gb|KRG98629.1| hypothetical protein GLYMA_18G085900 [Glycine max] Length = 787 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFFR 3 ALINMY+KFG L + +VFD M +RD+VSWNS+IAAYEQND P A+ FF+ Sbjct: 288 ALINMYSKFGRLQDAQRVFDGMEVRDLVSWNSIIAAYEQNDDPVTALGFFK 338 >ref|XP_011039801.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Populus euphratica] gi|743892938|ref|XP_011039802.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Populus euphratica] gi|743892943|ref|XP_011039803.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Populus euphratica] Length = 823 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMYAKFG L + KVF QMV+RDIVSWNS+IAAYEQN+ P A FF Sbjct: 287 ALINMYAKFGSLEHAQKVFGQMVVRDIVSWNSIIAAYEQNNNPVSAHLFF 336 >ref|XP_008373135.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Malus domestica] Length = 820 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFF 6 ALINMY+KFG LG+ +VFDQM +RD+VSWNS++AAYEQN+ P A+ F Sbjct: 284 ALINMYSKFGSLGHARRVFDQMEVRDLVSWNSIVAAYEQNNDPITALELF 333 >ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X1 [Glycine max] gi|571544149|ref|XP_006602168.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Glycine max] gi|571544153|ref|XP_006602169.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X3 [Glycine max] gi|571544157|ref|XP_006602170.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X4 [Glycine max] gi|571544163|ref|XP_006602171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X5 [Glycine max] Length = 824 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFFR 3 ALINMY+KFG L + +VFD M +RD+VSWNS+IAAYEQND P A+ FF+ Sbjct: 288 ALINMYSKFGRLQDAQRVFDGMEVRDLVSWNSIIAAYEQNDDPVTALGFFK 338 >ref|XP_004493379.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Cicer arietinum] Length = 824 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 155 ALINMYAKFGELGNT*KVFDQMVLRDIVSWNSVIAAYEQNDLPGCAINFFR 3 ALINMY+KF L + KVFD M +RD+VSWNS+IAAYEQND P A+ FF+ Sbjct: 288 ALINMYSKFCRLEDAQKVFDHMEVRDLVSWNSIIAAYEQNDDPNTALRFFK 338