BLASTX nr result
ID: Gardenia21_contig00029191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00029191 (728 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14059.1| unnamed protein product [Coffea canephora] 66 3e-08 >emb|CDP14059.1| unnamed protein product [Coffea canephora] Length = 135 Score = 65.9 bits (159), Expect = 3e-08 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 6/45 (13%) Frame = -1 Query: 722 LVLYPFKVFNVVVID------IVLHFICYLNLSFYHRHRKLVEKK 606 +VLYPF+VFNVVVID IVLHF+C+LNLSFY R RKLVEKK Sbjct: 91 IVLYPFRVFNVVVIDRNFILVIVLHFLCHLNLSFYDRDRKLVEKK 135