BLASTX nr result
ID: Gardenia21_contig00027957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00027957 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] 80 8e-13 ref|YP_009049781.1| hypothetical protein (mitochondrion) [Capsic... 59 5e-07 >emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] Length = 325 Score = 79.7 bits (195), Expect = 8e-13 Identities = 41/48 (85%), Positives = 42/48 (87%), Gaps = 3/48 (6%) Frame = +1 Query: 298 SLIECRLL---FIFHLIREGGREAKLSELYKADYYISRWRRKLFELPF 432 SLIECRLL F LIREGGREAKLSELYKAD+YISRWRRKLFELPF Sbjct: 250 SLIECRLLSEDFELSLIREGGREAKLSELYKADHYISRWRRKLFELPF 297 >ref|YP_009049781.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751792|gb|AIG89879.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752053|gb|AIG90139.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 103 Score = 58.9 bits (141), Expect(2) = 5e-07 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = -2 Query: 432 EGKLEELSPPATYVVVGLIKLAKLRFPPPFPY*VEN 325 EGKL ELSPPA YVVVGLIKLAK RFP PF Y VEN Sbjct: 26 EGKLFELSPPAAYVVVGLIKLAKPRFPLPFTYVVEN 61 Score = 21.6 bits (44), Expect(2) = 5e-07 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 323 NSSRHSISDYT 291 NS RHSISD T Sbjct: 61 NSRRHSISDLT 71